SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00056185001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00056185001
Domain Number 1 Region: 1280-1583
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000128
Family Rhodopsin-like 0.017
Further Details:      
 
Domain Number 2 Region: 1004-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000524
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 928-966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000133
Family EGF-type module 0.045
Further Details:      
 
Domain Number 4 Region: 653-695
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000769
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00056185001
Sequence length 1591
Comment pep supercontig:AMS_PRJEB1171_v1:HG381211:86867:91642:-1 gene:GSADVG00056185001 transcript:GSADVT00056185001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSMKYSCFFVYLLYYITALPQINLYFSEQVSLNEFDKIGVRYNCLQFAANLEHGSATRD
IAYFCMSESSSKFLIENVDEELLQRFSFNDLRKQSITDEELYRWSVPIDIIEQYQHYLES
NDLTLTEQIVYNCTLPRFGPMCQYELYYYHQNYSTLLEMIHGYYQSYEYELNYLACYTHL
KCIRGNAPACLDWTEICDGKVDCLDGYYDEEHCWQLELNECEENEYKCTIGQCIPLEFVR
DNSKKFDCLDRSDERAIYHPADEHFLTDRVLFAIEDMICETIFVTSSCRYQRIDHLIDTM
FSIKDPSVSDKCWFAFKCYFGLSNPEYPLITYDIIKEECIPILRKECPDVFYAPNIPLFL
GHIYTAYKKNDTLIASYTLLPYLCSNKSFHHEPLELVSNMPLNNTKCFVSPLPTIHDQTD
SGTTNFITRFVNVMNDIFHKIKNFDPIINFPSNQCNTPNLYQCMNSLKCISFHRLIDGRP
DCPFGDDENISEDMNPELFARLKDKYYHCYFNVKYIPKLFIADDRCNCGYYDGFCEDEDR
YRNFTRRTISFQTMCDFYEELYPITIDGENQTDETSCEQWECDNIYTRCDRIWNCWDGKD
EIGCDILSTIFNCSAKTRICVTLDTFQFSCLPIEKINDGQVDCLGGTDESKLCMKSYEQS
GNFYCMNSNPVTCIDIYDLCNNLLDCPGGEDEQFCQQNRSTSMNSGICGLDYLLLGTDIE
IFFCEFAKPKFKAYTKYFRISDFNHSWEDEEIENQIINVITTDDFNSIPLLDKSRCHLGL
NLRVWLNQASNNYTSTCLCTSGYYGDQCQYQNQHLSLAIKFHTLTESWQIPFAILVLLID
DTDQRTIHSSEQFTYLSLRDCNIKFNFHLFYSTRPKNTNKNYSVHIDIYEKLSLNYRGSF
LYPVKFPFLPVHRLAFLINIPSADSSKKNTCSNRQCRHGKCKKYVNEDRIFCQCDEGWTG
EYCHIQHNCTCSLKSLCIDKASDNRSICICPETRFGQRCYLHNRICESVPCKNNGSCFPN
NHFTTPNKEEYTCICPKGFSGDQCEIADTQLNIIFDESMQLSHSVFIHFIRIVPFNEHKT
VIPKTSSLRSTTLQTVSQATNSIRVYWSQPFHLTFIETLNKMYYLAVIQPIYNSSAKITQ
LIDTSYRCPSISELTNKTFAQLYVLRQMKSYHTICQQYSLQLSCFHDDLHLCLCYDYRGK
RLANCFNFDHNMKFDCSGQSTCENDGQCFQDSLECSKRFICACRSCYYGNRCQFSTSEFG
LSLDAILAYHIIPHVNLFHQTTIVRISFILTILFLLIGMANGILSLVTFKNRCVREVGCG
IYLFGSSLTTLLTMTMFGLKYFIYLSTQITITSNQLFFRVQCYSLDFLLRICLNMDQWLN
ACVAIERALTVIQGTRFDKKKSKALSKKVLIILSILIVLTSIHDPIYRRLFEEENENDDT
KRIWCVVTYSSNLQLYNRFVNTCHFFVPFLINFISSIILITKKTQRKSQLQGNRLDKDEL
RKQFRELQHLLIAPVILCILALPRLVISYVSKCMNSTRDSWLFLCGYFVSFIPAMVTFLI
FVLPSDFYRKEYRKSIVQYRKQIQQNFRSMI
Download sequence
Identical sequences GSADVT00056185001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]