SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00057063001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00057063001
Domain Number 1 Region: 1286-1584
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.22e-20
Family Rhodopsin-like 0.015
Further Details:      
 
Domain Number 2 Region: 1021-1067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000362
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 238-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000767
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00057063001
Sequence length 1592
Comment pep supercontig:AMS_PRJEB1171_v1:HG381231:82040:87053:1 gene:GSADVG00057063001 transcript:GSADVT00057063001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNMMQLIINITKLFCLINLLNEIQEMKCIPSFQLNMYFTNNEVQDNYCLYYHAYAKDNL
EYFLQHYLHTYCFRSDEYFKINSSNDQSFILFSELREQKITSEQLYFWSTSIDIIERYEM
YLMNINQNNSQMDSERFYNCTRSSFGPFCQFKLDIFGKSLHEIIYNSIELPLSIYEIIES
LQLKEPASCYVHLNCDYIYSLPMCFTWRDICDGKIDCLNNGIDEKDCFELELNQCDEMKE
FRCHNGQCIPLEFLNDNSQFPDCLDRSDEPFHTSLSCYKEPSMRCEDHRCELGSINTNCG
DGDCHDSNCPNGQTQRWRISLTSKPNSLSPDEPCWKIINRLSYIYSSWEDVTFMNFFDKK
EKIKEIRQYCPLIFLHPPYPIALGHIYYVYTKNQSYTFEYSLFALPTYICYNETLCPSLH
LFSQFPRSIYLSINSNKNFTCHELKSLSMIDISKVIEWYQLRYIIEDIYSSACLSISQIF
QNIDNNCQNYSQLYQCQNSRKCISKYRILDGIIDCPMGDDETYENSCSLTKIHHRFRYLI
NGTLKCVSPILYFNEKYSFFNEISNNPLISFQTLCDGFIERVPLILTNETDETNCDYTIW
PCNNTYTHCDSYWNCPKGEDELDCPSLFEKDDLCEKFQHICISPYTYDLKCIDLDKINDN
FVDCLGGTDERQLCRTISSETTSRYHCFQEDICISIYQLCDRENDCLHDDDEKMYYPIAK
ILCTLDESNKPSVLHFSLKGFEFYPTTISTKDLNDELFESKNLMKFEDTTRIIGLYRRYC
HRGLPIQVRSKSRDDDIREECLCPPAYYGSRCQYENQRIALTIQFQIESEWRTIFSLIIL
LIDNDNLIHSYEKLSYLSIRDCRAKFHIYLLYNSRPKNRTKKYFIRIHSFRGDSLEYRSS
WLYPIQFSYLPVHRLSFLLKIPRISNKEKCFLPCGLHGECKTYENNRISFCLCHSGWTGR
NCDVQYECPCANDSFCIESPKICLCLLDKFGNRCYLKQSICEKERSPYKFGNRCYLKQSI
CEKERSPCLNNGTCISHDRRFTGYIKLFQCLCPSDFFGDLCQYKKSFIELSNFREMSSVS
NLLSAHFIIANGQNPLEILTTIVKIRFDRPYLNLYPPKEFHILIIEILNEYYLMSILPNF
QYFNEIKLSLKTSQRCLNIKELFNKTIIEYHPLRRAKFYHLACREHVXDFKMFSLIFDTF
MCLCTNDHHANCFNFNFSSNHRCQNENHCLNQGQCFQDHIHCPTISICSCIGCFYGTLCQ
FSSESVRLSLDSILGYHIRSDTSIYHQPQIIQISFFIVLLIFILGIISGSFSIIVFAFSS
TARENSCGIYLLTLSIMNLCIVNAFLIKFLLLFFIQNGSIVQLWILKGNCLFSDYILRIL
VNIADWLNSCIAIERTVMVIMKIKFNSKKSKKISKWIILLIVLISLITSIQDPLNRSLIY
VEEDDKTWCISRLNSKKFLQQIDSILHLIHFIVPFLINLISSILIIFLTTRIRFSISRDK
FNENLRKQLRHHYHLIISPCLLILLSTPRIIIVLRNNCIKSVNNPLFPLLGYFVSFVSPA
LVFIIYILPSIQYRNDFKEIMKRIIIIIRLRC
Download sequence
Identical sequences GSADVT00057063001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]