SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00057453001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00057453001
Domain Number 1 Region: 73-188
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.36e-29
Family Lipoxigenase N-terminal domain 0.0095
Further Details:      
 
Domain Number 2 Region: 230-336
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.25e-20
Family Colipase-binding domain 0.036
Further Details:      
 
Domain Number 3 Region: 2-61
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000327
Family Pentapeptide repeats 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00057453001
Sequence length 353
Comment pep supercontig:AMS_PRJEB1171_v1:HG381242:31341:35420:1 gene:GSADVG00057453001 transcript:GSADVT00057453001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINANLSFIKCVYCIFINVKLDDTIFNNASLRYSKFINCIINTSQLDEATDLFGSTLYNG
TLQVNLGPQGQHSNKTIYNIRIQTGDEFQAGTDADVYLQIFGGNNSTDKIQLESVDYTPN
KFQKGRINEFTYEFDYLGNIKSVIIGHNEENPGAGWFLDWIEIDISMRNEIYRFPCYRWL
DRDKDDGEIVRQLTLSGLSFNYDEQMKSKFFISILFYSSFYFNLALYTTYQIRVVTSDDK
FDGDTNTDVSIVIFGESSHTDQISLTISKTYENPFKKGQTDIFEIETIDIGQPTKIKIGY
TNLDLLSDWLLDRVEIYISKLDQTWIFLCGRWIRNTKKKFQLEVELFPNIHNN
Download sequence
Identical sequences GSADVT00057453001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]