SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00057841001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00057841001
Domain Number 1 Region: 327-365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 2 Region: 204-240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 842-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000699
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 498-533
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000772
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00057841001
Sequence length 995
Comment pep supercontig:AMS_PRJEB1171_v1:HG381253:73002:76850:1 gene:GSADVG00057841001 transcript:GSADVT00057841001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLVRTYLFIIFPFLSDHNPVYLFNTEDNDNVEYYDCMLLDTVPYCRRPAIPLNLSRNHL
NSSCYHQGVHRTFAKLRNSSKNSREILHQFRSSIEKAEEYALYLSGHGKSQVICECRKAG
FGKNCEYQLLVEGHFPTFENSRKWQDDQRRKFRFSIHAFQKTLCYESLQCNSGLLCLDWR
DICNGRQECFNGIDEDLCDFLEFNECEIDEYRCSNGMCIPNEYFLDGEYDCMDSSDERHL
FKSNECGYQSDTFDCDERLCSRSEWSCGDGQCIDEIHRYNWKESVVTSDRQCFSMQNKNQ
KETMHFRLYCNTFWNLPNQFDESPEICQSWKCSQDEYQCRTGQCIPKHFVCDNEWDCFDA
SDELFYTNNFSIHNQRIQFKEEQLKCALNTKQEPQLFDGLCNLTKEYPCVVIDLTQGFLS
NDIRSCINFNQIGDMKIDCLGGIDERNTLKHCNGMNQLGFVFQCSSTSNQCFNDENLCTN
INQCLYPKELCSKNLIDCFRPNDFRCFNGTCIEHGRCNGNLDCHYGEDEYWCHSKRSLDN
SKYYRMIKERNQFSIDKQKSIQSSISMEKQNICVKRNLPINISSFTCNRGVSALNNRKNL
VCFCPPSYYGNYCEYHSDRLTSYINIDLSQSSYGRMKKTVNLTIKVLTLLIYENEIIYTR
QTHLRTWMDFDRIAKKRSHLIYSRDRKFLEIRKQRRRNRTLILNENSYSLRYEAYELNDK
NSIALIGVWIYPIHFDFLPSFRFAKTLHFYEKQHSSACSSNPCSFPHSDCHILQNNRSQY
ICLCKSGYSGENCSIYDQQCANQFCFPPSLCKPTYLGKTAGSHLPLCVCPLHSYGTRCAL
KHDQCWKNVCRNNGTCYPSNSEIGKFYCFCQDDYYGEKCELKKGRIDMKIQRNNTSEISV
IQNYYIDFNTFDLNLEYQDLIQQTSVLFSYKYEETYAPNIILFKSYSSFENQYPTMFVLS
FAFQMEGINISTALTEKNRCLNSKEVFPNVSGKLI
Download sequence
Identical sequences GSADVT00057841001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]