SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00057846001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00057846001
Domain Number 1 Region: 1183-1489
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.98e-20
Family Rhodopsin-like 0.067
Further Details:      
 
Domain Number 2 Region: 925-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 695-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000512
Family EGF-type module 0.023
Further Details:      
 
Domain Number 4 Region: 175-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000544
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00057846001
Sequence length 1500
Comment pep supercontig:AMS_PRJEB1171_v1:HG381253:85085:89917:-1 gene:GSADVG00057846001 transcript:GSADVT00057846001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILCIVLAFSSCALVNTRYSLYHSDINRISYPAYDCLHAHFVNNENYKEKYGSSSLQSV
PYCRRPDNDLVKDIKREAISYKSSENIVNIITFSQLKQQGITSNQLLAWFAPMDVVEKYE
RDENSSDVFYNCSTPWFGSFCQYRFNHNVSVSFEDIIEVTFYIHRYKISDLIHGTCYRFL
SSCNNELWPMCLNWRQICDGLNDCESGEDEQWCEQLEFSQCEENEFRCHYGGQCISLSLK
DDNPLESDCLDGTDEKFAVMYTGGDNECWHHSTFQYQERTSRYPANFQCGDGQYLYGVQL
PNEKTYCMNLRDREFIRVMLTSLNHIPNINCQQAFDYCPPLSEYCMFDWLVLPARPIFLD
FFQFVYFTNRSTDRFKDNIAPDFVCFNETKCPVLLVYVIDVPLIDGLVCFNPSTRDICLK
MGTEKSCRNSSYFYCNESMKCISKNRVRNGYSDCYYWEDELINSYQEKQPKQTEIRISEL
FPELCNLGITLFEQFLQGQETDETDCDWWPCSNPYTRCDYAFHCLDGNDELNCSNSVCPF
NEYECQVSPHGETMCLSKNHLYDKYLAPCQNRTLFRQIYFYNETSNISDQYLSWKDVQCL
TYNHLCRIDGDFEMTTNQENDCSHQFPKQISSRPQLVEHLQTKERVCRLRGYQSQLTTEF
FTSNELGYYPTPSMNLFMQTISTTMITPIGQQSDTRCALGFELYCFRGILVLDGPNKTKQ
CLCPPQYFGDRCQWQSQRISLTLKFTWYSATSSFVIFQIIIMLIDHYGSITPYYEQILYL
PTRDCSSKYNLYLLYPDRPKSLTSNYSIRIDLYEKKMLTYWGSWHLSIPFHFLPVNRIAT
PLHIPQEYDYQQSCFLSCGLHGKCTRYINKNSSFFCYCDKGYSGTFCNITYECPCAKDSI
CLSSSICVCPIHKLGSLCYVKHPICHPSNNPCQHNGLCIPNDDRISLTTFTCLCSQEYSG
ERCQNRNVQIIIHFNSIFNLATTFLYVNLITAFQNSIPERVVSLKKIPFDQKYIKLYAVK
PFNILFIQISHHEYYLAVLREKYLSSEDISTEVQLKHRCHHIKELLNETYLQYKPLRRVK
YYPFLCRQYSQLKCFRDHDENLMCICDVNRFSNCFFFNFTANYDCRANNVCKGRGQCIYD
GESCPTKFSCICQDCFYGERCQYSTSSYMFSLDPILGYHIQPNVSVHRQPFIIQISITIL
TIMFIIGLISGCLSVMTFGREKARQVGTGNYLLLSSISSILMIIVLMYKFWFLILTQQST
TNNRLVLKIHCILLDFMLKVLLAISEWLSACVAIERAVSVKQSTSFNKTKSKQFSKWIMI
GMVTMLMFIHIHDPLHRELADDIDIDQKRTWCLAQYSSRSMKIYNSFLTLFHFLVPFSIN
VLSAIWLILSLARNRAGVQCDQSYKQHLQHQFDQHRHLLIAPCLLIILSLPRLIISFISG
CMRSARQPWLHLIGYFLSFIPSMFTFIVFVLPSETYRGEFRAAIQQINKRVRALFFTQLK
Download sequence
Identical sequences GSADVT00057846001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]