SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00058976001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00058976001
Domain Number 1 Region: 1277-1574
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000146
Family Rhodopsin-like 0.012
Further Details:      
 
Domain Number 2 Region: 1004-1052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000542
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 215-252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000687
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00058976001
Sequence length 1586
Comment pep supercontig:AMS_PRJEB1171_v1:HG381277:51337:56097:1 gene:GSADVG00058976001 transcript:GSADVT00058976001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFDSILLLLFFIPSCFLNIQINFHLTDWSNSIDQFYHDCLQIELSFQRKPPYEIISYCL
SESSSQWFTEENHSDKKLTFLELSQQHITSEQLYLWSSSIDIAENYQIYLNQMLTTNEIL
LSRQIFYNCTLPRFGSYCQYSFDFYDSRYSSLNDLVYNFYYDNEYKPDTLTCYVHLECNR
GSLSACLDWTEICDGIVDCIDGNDEEYCWPIEIFKCKENEFQCYNRQCIPRSFFHENDGL
FDCLDGSDEGVAPHFDLPVNDKYLEPTFFYEDIICRSRFGLYVTVLTRSCSPGRQHLLLT
AMYSEKSQSINDICWSAFQCIVNTPDSVDFECSTLCSDGKCEEIVEKNCPDMLFIPTGPI
LFGHIYFLYTKIDAKYIPNRAHPPQYICYNNQFCDGLITNSTIFSFQNTTCRRPEDFSID
FYNLSPWIFEVGIVLYIDQVFLELYKCNTIRYNDKLICNHADMYRCINSSKCISKDRICN
KIIDCNYEDDEQCYSTDKNCLIYQMTNLFYCSLNQQCISSIFINDGICDCLRNDEDDTCD
DEYISASLIAKRITFSLICDGFTDILPIMINEQAYTDETECHYWSCNNTYTRCNQYWNCF
NGADEIDCDLKRPSINCSVHHHICVSPETNSFMCLPIEKANDHNIDCLGGTDEPRLCRTN
TYIQKSENFYCKSNISGICAHSSYLCNNQRQQCMFGEDFQFCQIQLDSLFTSMCWPNYDF
VRTDVETYFCDLPDDNRREIPLHFSIDFKQTLNTRKTVSLDVLTFDKAHRDDLHCHRGLD
MRVWLNIEKNITSRTCLCPPSYYGDTCQYQNERISFTVRFQVFFDSLRIPFLIIISLIDD
SDQRLIHSYQQINYLSIRDCDTKFNIYLLYAHRPKDRTRNYSIHIDIYEKMTLTYRRSLF
VAVDFPFLPVQRISTLLYIPRTYDIEEQCTDHRCIHGQCRRYFNHLDNSSFCQCYHGWSG
RFCTMKYTCSCSSDSLCLGISANNRSICVCPIDKFGPQCLLTTSICQSNSNTTCYNNGQC
IPFNEDIISMKKFKCICPRGFTGERCELTDTKILISFDQTMSLPQAMIIHFIRAMNNAPA
ENGTTFKIIPIIPNNITIYWTHPFHVAFIELTTSNYYLLIVQKLFQPTQTIKKSVSATDR
CKHVNEIFNQTILQLHFIRRMKYYQIPCQDFSFELSCFYDEKYFCFCYQFGFERLSNCLE
YNLTKKPDCFGRNHCENGGKCLQDNVQCPQTSICLCSACSYGRLCQFRSNGFGHSLDALL
GYHILPHIQIWRQPIIVKISGILTIIMGTVGFVNSLIGIITFREKDLRTTGCAFYLLGSS
IASLFTTIIFFLKFWILVTSQMAPITNRSFLRFQCLFVDIILRITLSIDQWLNTCVAVEQ
AISTIQEDRFNKKKSKIIAKYMIIIVLLLTIGTAIHEPFHQRLIDDGDEDEKRIWCIVTY
SNQMILYDSIINMFHFFVPFLINCMAVILILMKLTRQYRIQRTTQAYNRRQLREQFQQQK
EVLLSPLFLVFLASPSMIIYLVTNCVESPNESKTFLFGYFMSFSPSIFTFFLFILPSKLY
KKKFLKIFHQYRIAIQTRLHRIRYGI
Download sequence
Identical sequences GSADVT00058976001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]