SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00059407001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00059407001
Domain Number 1 Region: 1288-1594
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.4e-17
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 2 Region: 1020-1069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000574
Family EGF-type module 0.02
Further Details:      
 
Domain Number 3 Region: 582-616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000303
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00059407001
Sequence length 1600
Comment pep supercontig:AMS_PRJEB1171_v1:HG381290:7843:12645:-1 gene:GSADVG00059407001 transcript:GSADVT00059407001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFFIDFLYCALLYWVAAFPQMNLYFTNELDANNSGIVFQHDCFHIPASVKKDSKTHLII
HYCLTEWPLEWTIEENSIDKNLTFADLYKQNITTEQLYLWSAPLDVMEHYEYYLNHLSNA
NQSGALAKQVFYNCTSPRFGTSCQYSFDSYIVKTNDSTLYEVIHEFYQQDYNPENLTCYM
HLACNRGSKSICLDWSEICDGTVDCQDRIDEGSCWELKISHCAQDEYECANKQCISQSFL
HDGPHSFECLDATDEYLKIGTNNFGLNQVVFGEPTFEEEDIICPIRYDSPSHLFKLTSSC
TSKRNQLLGQLLFDSAPALISNDCWIAVICQLDIVQLPNQQCYSHCSGFTCSNIINHTCP
DMINVPAGAVLFGHIFFVYTKQDLLDPLFRMLPPRYVCYNDQFCDGFYPNKSLLSFDTST
CRHPVDFPLDFGRPPPKRTWLNRYVLPLYQKLSQCNKINHNYSSSCNNVTMYQCMNSSKC
IPKYRLCNSVADCDYSDDEQCSSINGSCLLYGLDDLFKCNTQNLCISPVLVQDRECHCST
DEIGVCEDEQISLLYSRSQISFPTICDGFTELTPIIINGRNETDETECEYWQCNNTYTRC
DGFWNCFNGADEVGCHALSSLLLFNCTDEYQHICVSPKTNQLTCLPLAKANDGRIDCAGG
TDEPQLCRSLDHHPSFTNFYCRTNLGEYCVAYKHLCPLNNYEINADEKFCYTSPDMMQKR
NISSEAYRSRPSGVENFLCTREIDVKKPKIKYFSLGKLTDSIDQMAPQQTNDMIFDSPIR
QINVHQQKQRCQRGLPLQVWFNTKRNLSIETCLCPPSFYGNACQYQNQRVSLTLRIQTYS
DSRRTLFTLIISLIDDSVERNIHSYHQLTYLYIRDCQTKFNIYLLYSSRPKNLTKNYSIH
IDIYEKISWIYRGSYLVAINYPFLPVHRVAKELYIPRSRGNLQHCSDYQCVHGQRIRYVE
TSHDVCFCQCDSGWYGKYCTLSYVSECSSDSRSIGITVTNRSICICPLHKWGSRCLLNNQ
ICFANRTATCHNNGQCIPNDNSVSFGKEYSCICSQGFTGERCETEDNKLILSFHKDIVLP
QTVLIHFIRVMDNGPPENGSTFKTILTYQNAITVRWSRPFHVAFLDLYNRNYYLVTVQKH
YKPMSTVVRTINPIDRCKHISQVLNKTILELHPLRRIKYYQLPCEQHSPVLSCFYDDKHI
CLCSDHNRRRSTNCFEFNHHSEHTCLGQSICEHGAHCVQDRAICPQTSVCICPKCFYGTL
CQFSSNLFDLSFDVILGYHIQPNIPLIYQPSIVQFSMILVTILILFGIVNSILCIITFEN
KDLRQTGSGIYLLSSSILSLFTLIIFALKYGILIIAQMTYIENRPFLSFQCISIDFLLRV
GLTLDQWLNSLIGVDRAITVIKGTSFDKKNSRKMAKYFTFVGIIMAISTTIHDPLHRQLI
YEDGDDVNERRIWCTLKFSNSLRTFNLFIVMFHFFLPFFLNVISAVIIIVMTTRQRTTVQ
KQLSYQNQLRIQLKHYSHLLTAPCLLVILALPRLIISFVGGCMKSTSSSWLFLIGYLISF
TPTMLNFFIFLLPSETYRVVLKNTIKRYRQNIRTRLHLHP
Download sequence
Identical sequences GSADVT00059407001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]