SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00059855001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00059855001
Domain Number 1 Region: 146-281
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.57e-21
Family Pentapeptide repeats 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00059855001
Sequence length 302
Comment pep supercontig:AMS_PRJEB1171_v1:HG381303:50790:51698:-1 gene:GSADVG00059855001 transcript:GSADVT00059855001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRISVGNSVQMAKKLNRLTLVKLFFSALIPLTIGLFTVITTIQQQKSSTAQREQDKQDAL
LLRQQSDLQAENLHKEKVYATYLDDVSELFTMNNSKDTLMKIRAKTLATLRQLDMDRKKH
LLLFLYDSELIYHSPEKTISSVLRVDEADLNGVYFRGTVDASCSFMYLYLHYVYLSNASF
INCFIDRSNFSFSIMYKTVFTKTRFLRTSFRFALLGKADFSLATFFEMDFIGASLVECNF
TGARWVKKNTDFIGTNLTGAIISNELLKKSKLYNSILPNGTWGPILGRNLVVNGNAERNV
SI
Download sequence
Identical sequences G3KGW8
GSADVT00059855001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]