SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00060083001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00060083001
Domain Number 1 Region: 1257-1560
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000851
Family Rhodopsin-like 0.011
Further Details:      
 
Domain Number 2 Region: 202-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000334
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 983-1029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000691
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00060083001
Sequence length 1566
Comment pep supercontig:AMS_PRJEB1171_v1:HG381311:37260:42287:1 gene:GSADVG00060083001 transcript:GSADVT00060083001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFIIWLNFFYLNGKYYYLYDNDCLDYNATDYELEPELVTNEHQIISFCRVDNFEYEQYN
EIDKDISQLTFYELYIQNITSLQLYQWSVHLDLVEEYQAFLENRLDINILTANLTIYNCW
IKQKFGRYCQYSFDSQKPFATIVDNALERSVSLSFNGTCYMHLNCKRNNVTWCLDWRDVC
DGKVDCWPNHVDEQFCESLEQNQCDLNEYRCMDGQCIPDIFYLDGSFVPDCLDGSDEDIR
EKYKYACRKGDNPSFKCRDVKCRHWIQSMSSTSCRPLAEIERNSIITRQMDEDLLLPDVN
THINKGCWTTMICLNNPTYAHLFNGSCRNICFEPDIPCTKRLMEYCPSLFEFPALSVGWS
DLHFIYGWNRTNTSLGYPNYVCYNERRCSISQSNIYFKKKSESSTILSCEFLHLDYINIE
WITKLQFYRKHMHQQCSLATDINENYCSEHTQFRCAKKCISKHRIGDFFQDCINFMDENL
YNDTCNLNLKHRLACTFDIAENKQVKCLRIINVLPQSRMICTDDLEIPHFPTLCNGLTEF
EENIETNCEMWQCDNQYTRCDGIWNCPNGEDENNCFHEICNGSIGQPCLLLYTAKYICLP
IANISDGIVDCIGATDEQQACRNIEERVGKYRCLTNRTDNKQFANETQQCIHVDDTCVEK
SMCIVPELKWSPLCKDEDFFVTLCIRFWTMDRRITEHNIMCSLDENLFFHTYWKSKRPQF
SMNNYNIISAVGKSLVDNSKASIVTNRKKSTPLIHFTKQGIVLNNFQCHGGIPIYSTNQI
KCLCPSFLYGLQCQYQNQRISMTLEIGAPEWRIPFVFVIYLIDETLEIVNSYYQIRYLSI
RDCNRKFHFHLLYSTKPKYFDHKYSIRIDVFEMNTLVYRASWLYPILFPILPVYRLSLHL
TVPFVSLSSCTLKCPVDRSQCSLYRNINQFVCRCKSGWTGSMCTIPYKCNCSPDSICVGT
WMNKSICVCPTYKFGRRCYLKNNLCERSNARKCRNHGQCIPGIVQFPRSFPTICSCLYGF
HGELCEFRDSQIDISLHMSNIPDSLLIHFITVNSHMNSLPYEPILKYGPHERATTFKRIT
FDKNSVRIYWQNPFHFIFVQYNSQIFWIFSQLKYNRSLHLKLTLQSYFRCPSIQENLLNQ
TILNYPRNQRVKYYHIPCQTNFNLTCFHDQDQYICLCTFDHRANCFTFDHQIKYSCQQLS
YCENGGQCFQNNLKCPSSAVCSCPKCYLGTRCQLSTRGFNLPLDVILGYRIRSGQSFSQQ
PISVQFSGIITMFMFLFGIINGILSILTFQVKELQKIGSVIYLFIASIISIIIIIIFTLK
YLLFVLTQILMISNRQFLFSQCITIDLLLKITVQIGDWLYACVAIERLITVIKEINFNKK
FSKIIAKWIILFVCLTVIISSIHESFYRRLIDDEDQERIWCILDQSNALNLFTSITTVFH
IICPFIINIISALGIVLMRIKSRLNLRKDQNIYEHIQNEFHKNKYLIISPIGLIILVLPR
IILAFQLECMKPARESVTFYLIGYFISFLPSLSLFIIFILPSRKYRQVFKKSIQSRWKKF
SQWIHC
Download sequence
Identical sequences GSADVT00060083001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]