SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00060124001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00060124001
Domain Number 1 Region: 881-949
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.22e-26
Family AN1-like Zinc finger 0.00016
Further Details:      
 
Domain Number 2 Region: 13-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.17e-18
Family Ubiquitin-related 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00060124001
Sequence length 954
Comment pep supercontig:AMS_PRJEB1171_v1:HG381312:71053:74393:1 gene:GSADVG00060124001 transcript:GSADVT00060124001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPTSQASPAPSHRCLIPINIETLAGSSFELLVSPYEQIQYIKRKIERREGIPVSHQHLV
WKSNELQDESCLHDYKIEASSTIKLVLAMRGGPVNTKRVPIEDSLLRDVSEYMENSRDDS
ILNTDLLPSSSNKNVTFLVLRDGDQFNFFQVIDRGDGTLSPLSGSVSNASMYSTHETIAI
EPEREKDEKRQNDNRKTKEKMESIRSKLKTNEKKDVLSLRPSSTTKQSKSNLIEHQPRNI
RIDSSSNLSMKGNNSPRTSSSEQQSTPRLVPYKFASTNLFNTYNILAAAAIEQSDFLHEE
DSEDEDDSHDEDDEQHVQGEQQRILSPPPSMIPVNSKTQHLLTSRSYSPSVFCHKKHQYE
QEPYKKSLYHSHHQDRTTKNLIGQHESASTLDSYAQSSMNTILTTSYPSVTLGPVGQETA
ITTAATTSGNETSTGPILVDYISRISPTLHQQQVPIVSTSSRMLSATMTKRASLCETSPV
STNVECILNNEEEKITSSSELVYQQSQTSPMLELLDDDIISPTNGLISAASIRDDKTETS
RKQTAEIQSRNDTSLSKPIWTDDDDQLNIGDEYIGEERTSTSQSILSQHRNSSISATVIT
PMPTLPSVIKKSTLPSTKQQFYHHHKPLNTDQQQAKSSPRPLMPFSLSKYRRIPANVHSI
TSSQQQTYTGISNTSSNDLTNNGNGNVNVNNTTDSFNEHLILNKRIEIMKTTGKQQASQA
SPIASSTSTTMFSSTPPQSKRHFQQQSQQQDIKSVGATGIVHAASSSSSSLIPLDNTKVT
IETIGPKTVTALLRQNATIEPVDTSRGVGKHLVSLLTTASKETTSVKPTYKQSSRDVVIE
ERFKLDSKLNNPWSSAASNNSSTVSSSLLSTAATIYNPNKLPSVIVNRKSTSKCFLCKKK
TGLATTYQCRCGSSFCSEHRYPEAHACAFDYKAEGKRLIERNNPLVTAPKLPKI
Download sequence
Identical sequences GSADVT00060124001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]