SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00061034001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00061034001
Domain Number 1 Region: 1254-1561
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000549
Family Rhodopsin-like 0.021
Further Details:      
 
Domain Number 2 Region: 1000-1041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family EGF-type module 0.03
Further Details:      
 
Domain Number 3 Region: 219-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00061034001
Sequence length 1566
Comment pep supercontig:AMS_PRJEB1171_v1:HG381341:2343:7043:-1 gene:GSADVG00061034001 transcript:GSADVT00061034001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSIQLMIIFLSLLIVTGYYSLYNSDDREKLNSVFDCLYAYMINSDLVDDGSYKIHYHLI
PYCRRLDKNEEHENFSIISYGNIQSQMKFSELHKQNVTSLELLDWLAPIDVAERYEINSH
NSDEIFNNCSYPWFGSTCQYRSIDNISSSFERVVQFIIGNRSKAALNLIYTIGTCYPFLN
NCYRGPSPICLDWREICDGNVDCINGEDEELCSIMEINECSNDEFRCHYSAECIPWTFVR
DGVYSIDCLDGTDEMTGFFPSRLTIDSRILCPAMPTFQCEESASSRPLSFSCGDGLFQFE
SPPRFQPYCHNLRERQMTLTIFTSLDYISEVKCRQALLCLLGINQMENILSIINKDPCES
FSDPGESLSDHCMSKWIIFPEYPILFRFFQFIYFTNRSIEEFKINILPDLICFNKSICPG
LLYCSIDIQIHNGLNCCQITFEIDKWGDVPEMFEDLIFRCALIGKDKNCSDSSLFHCRNS
SKCISKRKLLDNYADCYFYEDEDVSGCELNDTKRFTSIVNPNKCYSIVGIEPREKVGFNS
RYENPIYKISAWKRPFLFQRICDGSIDLSQVDDSDETDETDCQWWPCNNPYVRCDTFWNC
LNGLDELNCSHNSCSANEHVCIRKESQENFCFPITHLMEDYTKFEIEEGIREIYLTNKTI
SNIRNYLFWNQTKCITPEHLLRGHSVLSLTDGDVCLMTNDTADSRLMKYRMEIDQLFCSF
TFRVGLINKRPFFLTSRLSYFPPVLSTEVSIRRTSPLSQSKNFDLPIDMEKYWYCNRGIP
ILFKTSNSSKCLCPPSYFGNRCQWQNQRISLTIQLIYRNFNLTYIMPIFELILILIDEQG
QIGPYHERLTYVPKRDCGIKFNIYLLYPDKPKNLSANYSIHIHLFDKMTLTYWGTWHLSI
PFQFLPVNRISTKLFIPNIKEFGFLCPLSCGNYGKCVPYINKNDSCFCKCDKGYSGLKCN
VKENCSCSLDSYCLTSSICICPMNKFGRKCYLNNSICQLENNSCQNNGQCIPIDDRIGMK
KFTCLCPENFNGEKCENKIQNIIDIEFDENIIKSDSAVFVHLMRSFGGENLQHTILLKKI
RYGQNRIRIYVTISFHIVFIESINGNYYLIVVREQFIESEYIETKLLSNQQQCVFIDQLL
NITIKSYSYLDRIKYYPFFCRQNKELMCFYDENYMCLCDLDRFSNCFMFDHNAAYDCQGE
NDCENGGKCFQDNTTCPVVSLCICPDCFYGTKCQFTTQGFVLSLDYILSYHIKPNVSLSE
QPIIVKMSIVIITITSVVGLISGILSVLTFRRKKTRDVGVGLYLFVSSWISILIIIILLI
KFCQLILFQMRIVTNSTLFTINCILLDMIIKVLIASNDWLDGCVSIERIVAVMKGVSFNK
VKSKKLAKWISLTVIIVIILTHLHDPLNRHVINDIDIDEQRIWCLVKYSPSINIFNSFIT
LSHFLIPVAINSCSIIIVIILVARSRSIVRPSLSFIEHLKLQFKEHKHHFIASCALVLLS
IPRLIISFISGCMKSPSNSWLFLFAYFISFLPSMMIFFIYVLSSTTYKEECNIIVQKIIR
RFRNRT
Download sequence
Identical sequences GSADVT00061034001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]