SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00061283001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00061283001
Domain Number 1 Region: 114-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 268-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000678
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00061283001
Sequence length 544
Comment pep supercontig:AMS_PRJEB1171_v1:HG381350:67943:70113:1 gene:GSADVG00061283001 transcript:GSADVT00061283001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFINLIIFLMLIQFKDIQGFLGCKDPLVPCLNATDCIPIKDVCVTRQNCIDLKSLRSVCK
NKYCKPNSGRSKSCVTEVNDKLKYECISETKLCNKRFDCIDRSDETDRVCHGEICEEDEF
QCPTGACILKKEMCDGTQQCSDGYDERKDFCRNKTMSLEVFSLFPENNDTNSSSKTYECA
PSSFFTQSIYLLPNLVCDGYQDCPMGDDENDCKNDKCDSKSICSTNSDIICIKHPVVKEL
CRCKKPGYEIAANLTLCQDFNECNDSVRDYCSFECTNTDGSFDCSCPSKFNYDQKTKTCQ
RKNDVSTPYLLAVLKDNINFYDISNSTDQYSAKLISTSNIDSDHHFDYIQYDPVQMFVIY
YDQIQQAVLCKANDAPKAIILLSNLTLHGFVYNANEKSLFVIENQSKTLRMYAPIACDVS
INIKMHSWTMNDLSNSIHSMEIDIYRRQLIFASKTQFMISSMSEPNSTKIVHNAHSEIKR
FIYDSLFKRIFWTTNSARNDGSFPVHTCDDQFKQCHDTYIPLPHPWPFGFFNVDKFCFSP
IHQK
Download sequence
Identical sequences GSADVT00061283001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]