SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00062898001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00062898001
Domain Number 1 Region: 139-212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000506
Family Glycosyl hydrolases family 32 C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 37-101
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000589
Family Pan module (APPLE domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00062898001
Sequence length 213
Comment pep supercontig:AMS_PRJEB1171_v1:HG381403:9832:10530:-1 gene:GSADVG00062898001 transcript:GSADVT00062898001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQNLDFGLIVLSTSNGSQQTSIGITSRDNTSVMFNWDLTGWDYFSVPSIIDWSSCQIAC
NKDPKCQAWTFVKDRQINNNCFLKSGIPFLTSNSVCISGVKQRHDDKQIIWIYMNRILSQ
KNPDAAHNILHAPIWMESTNANTHWFLQLDIFIDHSVIEIFEPQGGRFALTGHVYPEEEN
ADNLAVYVNEAPNDDDSIVIDTIDVWKLYTIWT
Download sequence
Identical sequences GSADVT00062898001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]