SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00062959001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00062959001
Domain Number 1 Region: 1270-1572
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000824
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number 2 Region: 998-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000325
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 459-489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00062959001
Sequence length 1580
Comment pep supercontig:AMS_PRJEB1171_v1:HG381405:53081:57823:-1 gene:GSADVG00062959001 transcript:GSADVT00062959001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVNYLLYSIQFYIIIAIPHFNLHHTDWTNENESYITLQHDCLYVSVSTEKGTDSYQTIS
YCLTEWPSKWKLVENEYDQKFTFEQLYEQGVTSEQLYFLSASMKLIEDYQEYFDQRSIKS
NEIKEPSAIFYRCTLPKFGSKCQYSLDTYRFYHGSLNELVYEFYNIKYTPTTRTCYTDLE
CDRGLSSICLGWYEICDGIVDCFNGGIDEKYCWKLKFNECSDNEYQCKNGQCIPMDFFQD
RVYGYENIECLDESDKYHIIPLIQIKPRSVEPTFFNEDIQFIRYKTARSSVSRHIELLTG
QIFIETPSSITNDCWLAFKCHYNIMHNIDPICDSGNHFNISFLDIINITCPEIFMIPATP
IAFTHIYFLYLKEIIFKSDYTFTPHYICYDTRYCDGFLSNRTSISFNNLTCRKPEDFPVF
FTEEKINSKIEYYIDEIYKQLNRCNTILYDNSTICNNFQMYQCFNSTKCISTDQLCDGII
DCNNNDDEYCPLINDTCKKGQFKCTLTEKCISIHLMHNIDCDCRTPSIESCEDEIDLFDL
RKDYIPYRLVCDGYLQLKPILIDNRYESDETECDYWDCNNTYTNCDSKWNCWNGADEINC
NPIVECPFNHHQCISPETNELICLPLEKTGDGHIDCIGATDELKLCRLTQLTPFKNFYCK
NDTNHTCIYSDRLCEENNRCMNGEDQQLCSSMENISKIETICRYAHESIYKKEHHFICNR
RHEEYGLFERYFKPDHMKFPKKSPTEQIKKATKMIEHLSPSEITRSYQQRCHRGLPLHVW
LDNKNDVSIEACLCPPSYYGETCQYDRQRVSLTLQFKVHTDSRRILFTIVISLIDDDSNE
RTIYSYEQNTYFYFRDCSKKYNVYLLHPKYSYSKTYAIHIDVYEKISLIYRGSFYIPIPY
RFLPVNRIATQLIISGKINGIKNCSNQLCQHGQCLYYINDQQNRTFCHCNQGWYGKFCTI
PHICQCSSDSPCIGVTANNQSVCICPVNRWGARCFLHSNPCQSNGNPLCLNGGQCIPDDK
QSQLSTTYFCLCRKGFRGEHCEITDRYLKLSFHKDIILPQSIIIHFMGLEKTNNRFLSSN
SAVQRISLYQNEIYAYWTNDFLIVFIQLLNNYYLTLVPDKHNAPLTSYNQTILPSYRCKH
VSEIFNETILSLHPFRRLKYFQIPCEQYAPDLNCFYDDTYFCLCYDFNKKRLSNCFKFDS
RSSATCQDLSDCENGGQCIQDGLKCPRASICVCPQCFHGTRCQFNSHLFGLSLDAIIGYY
IQPHVKLIDQSFIVKLSLTLTILVAILGVTNGILSMITFKSTELRKSGCGLYLLGTSITT
FFTITIFVLKFSILLQAQIVYIMNLTFLEIQCYTLDFFLRISLSMDQYLNACVASERALT
AFRGISFDKKKSKQMAKYIIILLLFWTISTTMHDPIHRRLLQDNDDDGEESEKRIWCIVS
YSSSVRIYHSIINLIHFFVPFFLNLISALLIIFITSRQRRKVQHRLAYRQIIREQFQEHI
HLLIAPIVLVLLALPRLILSFIAGCMKSSRDVWLPLAGYFISLIPPLLTFIIFVIPSKFY
MKEFQKSITQIQTRIRSYFS
Download sequence
Identical sequences GSADVT00062959001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]