SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00063128001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00063128001
Domain Number 1 Region: 1169-1464
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000421
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 2 Region: 569-600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000851
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 140-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000101
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 96-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000105
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 5 Region: 905-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00063128001
Sequence length 1465
Comment pep supercontig:AMS_PRJEB1171_v1:HG381412:43472:47869:-1 gene:GSADVG00063128001 transcript:GSADVT00063128001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSFTFAQLEEKNISSQTLLSWSASIDLAEHYEIFLNNQSNSSLSLFDNEVQFYNCTPP
WFGPLCRFAFDLDDDRSFAELVVRMLKSKDNLIETSRVTCYTHLKCQTSYLCLDWREICD
RKIDCLDASDELNCWQLEINECNENEYRCYNGQCIPKEFFHDGLINPDCLDRTDEPSYFD
YPKYCSDDPSMRCEEHTCRPGEEEFTCGDGTCMREISIWSMCKNGRDNLLIENDCARAMA
CLMRLHDRIREWCDDYCMLGDCVKDKCPSLYQFPSNPILFGHVRFLFMNDGNQFDPDDLP
LPVYVCYNEELCEDFLTDAIYINGSACQHFNVLGLDEIDSDAFWDTLVSYVKDRFRVCLV
ISNETYYLNYTTMYHCENSTKFISKHRLVDGIQDCPLHDDETFNQSCSLRDANYRFSCSV
DDSTMCVAPLNIQDGKKDCPYGEDEYRKQDLSLKTHIYFQKICDGIEELLPILIDEQNET
DETECIHWQCNNTYTRCDGYWSCKDGADEFNCLPWICPDLHQSCIFLNDTSRVSCLPISQ
VNDDISDCLGATDERNYCQSIYLTRAGKNYYCQNDTTCISSIYLCNGEKNCPSGDDESSC
TSEQSFHSYGYCEQNLLPQTGIESFLTRSFCDMILPRKIYFTLRDMPIYPLQLMTENITL
VSLSENKTQVINSNNEIDDMQYDNEWRCNRGLLMHVRVDNETDELVCLCSPSYYGDMCQY
QNQRVSLTFQIRVTSDWRTLFTFLITLIDDEENIESHDYIEYLAVRDCDTKFNIYLLYST
RPKNISKTYSVRIDAYNKLTLTYRASWIFPLQFSFLPVHRLSLLLTIPLSDVEPLKNHAK
SCFHGHRFHYVNNQSLTFCQCEHGWSGNQCSNKYTCKCASHSLCINNFICICSLNHFGSR
CYLHHSSCHSQSCTNSGQCVPTDERYIDKYLNKSTCICPEEYYGDRCQYRQTRIDISFHK
TLTIPQSLLVHFITIEKDVEPIRRSLMKHIAFDQNSLLFYISTAFNIAFVEIFNNYYLII
LREQRIISVNLSTKIMPSFRCASIHELFNNSFANQHLLKRIKSYHIPCQKRLELVCFYDD
IHFCLCDLNRRSNCFEFEHNLTNDCHGQNSCENGGQCFTDDPKCPTSSICVCPECFYGSR
CQFSTKGSTFSLDTILGYQIRPNIGIIQQSLIVHITTAVTTIVFVLGFVNSFSSFLTFQR
ETICNVGCGFYLLTFSITSMITIIILTFKFWILLASQMNWIQNRWFLRIQCISIDFLLRF
LLSTGDWLSACVATERAVNVLKGIYFNKVKSKQYAKWMVLFVLLFTITTHIHDPIYRNLI
DDKEEQRTWCIVKYSTSIQMYDWALNILHFSVPFAINCISALVIIVATARTRSNIQKTQS
YKKILHEQFQHHKHLLISPFILILLALPRLIISFLSGCMKSARNPWLYLIGYFISFIPST
LIFAVFVLPSKIYMKGFKESIKRFW
Download sequence
Identical sequences GSADVT00063128001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]