SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00063202001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00063202001
Domain Number 1 Region: 818-1103
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000076
Family Rhodopsin-like 0.03
Further Details:      
 
Domain Number 2 Region: 131-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 483-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.039
Further Details:      
 
Domain Number 4 Region: 558-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00063202001
Sequence length 1121
Comment pep supercontig:AMS_PRJEB1171_v1:HG381416:5482:8847:-1 gene:GSADVG00063202001 transcript:GSADVT00063202001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFRTWSSIITIIDRYFRKCSIRYKNDTTSQFQHSVLYCCRNSSKCISKHRLNDHISDCY
LNDDEEEYESSCLPNNTQRFKCDDEKKCYSPIVSREICPIRYQLNLDEINIHHICDRDVQ
MLPVLIHGQNHTDETECEHWKCNNMYTRCDGFWSCPNGEDEANCTTKRQICPLKSLACVS
PWNYTMICLSAHRVNDGNPDCLGSADELHYCRRNIRYDNKYYGFRCWNDTQCIGDHELCN
KRQNCMFNDDEIFCGDYQESCEACEYVNCTDAIKTLCPIGYLGGVKFSLATLPVYPSSSG
QRRIEYISQQSQNLHSIEKLITTEPYDRTWPWRCNNGIYVSLWPGNNSSKYRCLCPSPYY
GDHCQYQNQRVSLTAKITVFDSKGIYSLIVSLIGEDGDHEEVHSYHELISISNRGCKRVQ
NAYLTYLSRPKNNSMNYSIHVDVYDKTNLKYLTSWYFPVPFTFLPNNRMPINLAISNDQP
FRPKHCSLTCHNGECMKYINDVKIFCRCHTGWTGARCDIPIRCSDCSSDSMCIGMIHNRS
ICLCRVHRGGPRCLLPLSCPNQLCDNNASCVLIDDVPNDRGFLCNCTEGFMDLFCQIPKP
RLEISLHNIRISSSIVLIYIFWHSNNFMRFEQLEQTVLPQQLKMFQKSILIYTMMHFRMA
FINIDENIYLIVVQQVDQYNVTTSVNPSQRCPLINEVLNSSLASLHQIRRMKYYYMICQT
HLSLQCFFDEPYMCLCTIDRDANCLKFNATSPVCRHNTYCENGGRCLNDGTLCPVSTLCK
CSDCHFGDRCQFHAKGIGLTLDDILRYDIQPNVNLFDQSILVKCCALLTIIMFLIGLINS
ALAVLTFRMKKSREVGCGLYLLASSVTSLLTVSMLTVKFWFLLFTQINLTANNSIVYGGC
RSLEFILKVCLYMDNWLNACVALERLMTVKTGVSFNKLLSKRIAQWVIFCLPFVIMVSII
HEPIHRNLFEDKYEERVWCLFLYSRSLHTYNVFVSLFHLLGPFCANLCSAVFIIIYTARQ
RAVLQSRISYRQHQWQQLMEHKHLIISSVILTVLSTPRIIIAFLSGCVKMSHNSQLYAAG
YFISFMPSVSIFIVFVMPSDFYKEQFTKSVKSGLNFIVRRQ
Download sequence
Identical sequences GSADVT00063202001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]