SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00063245001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00063245001
Domain Number 1 Region: 1169-1464
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000211
Family Rhodopsin-like 0.021
Further Details:      
 
Domain Number 2 Region: 146-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000574
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00063245001
Sequence length 1465
Comment pep supercontig:AMS_PRJEB1171_v1:HG381418:42546:46943:-1 gene:GSADVG00063245001 transcript:GSADVT00063245001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLDSTNSIDFNLTFAKLKEENITSNMLLQWSASIDLAERYEIFLNNDLNFLSWREMLF
YNCTSPWFGPLCRFTFDYGMGRSFDDIVNYAFRKKDEIEQNIEMTCYQHLNCQTKLSCLD
WREICNGKSECVDNSDENNCWQLEINQCNDKEFRCHNGLCIPIEFFNDDGRHPDCLDRTD
ESGPQDLSSSCYSYPVFRCEEHMCRPGQNDFPCGDGECTNGIDICENRRTSYIQADFCSN
ATACSMKLYNLVDREWCEEFCSDLTCIKDMCPMLYEFRYISFLLGHVRLMFSNESIEFGQ
FSPPEFVCYDEKLCSDFLPATKKFNNFTCRRFNELGLKSTDSDFTIKTLVQNIKNIFRGC
LIPTNEIDHCNYSTMYRCLNSTKCISKQRLVDGIRDCPFDDDEIFNQSCLLNDVRQRFKC
YSNGQEKCFASLIIEDKKEDCTNGVDENIEKNLIRTSIYFQTICDVRTDLLPILIDDEYE
TDETKCDDWPCSNTYTRCNRHWLCKDGADEVDCLSSTCPVLHHSCIFHNDTSKVSCLPIH
QAGDGIDNCLGGTDERKSYSRESMNGVEYDFHCWNDSKSIKLDKICNNQTDCKFNDDESF
CKNFKLSGLMNCHPPVRNIESFVCKDRTVFRAANTYFKLYNMKNYPLSLSTDTRSAFFED
QDRSLFVDPIEFNSDYEWLCNRGITIRIRMDDDTKKSYCLCPPSYSGDKCQYQNQRVSLT
VQIQISEDWQSIFIFLITLIDNERNIQSHDHIEYLPIRECRNKYNIYLLYSTSSKNLSKT
YSVQIDAFNQLTLNYRISWIFPLRFPFLPVHRLAVLLKIPAFNINVQYKCMLPCIHGQCF
AYINDPMSTFCRCEPRWSGVQCDIEYECNCSADSVCISDSICLCPPGRFGSRCYLSQHSS
YAELCLHGEQYISKDIRHVSSDSNDYICICKEEYTGPRCQYEKKRTRIHISFHRKVSIPS
LLLVHFVTIGKQKKLKRRSIFKKIGFVQYSLVVYVTEPFNIAFAEMSDQYYLIVLMEKSI
VSSNISTEIIPSHRCRSIIELFNETFANQHLLKNIKFYHSPCKKHLDLVCFYDKVHFCLC
NRDRQANCFEFDHNMNYTCGEYNICENKGYCFQDDPKCPTPSICGCRQCSFGRRCQFSTT
GATLSLDIILGYHIQPRTGISQQSIIIKVAILSTIFMFVLGFINSFLSIITFKEEITRQV
GCGIYLFVSSILSLIIVIVLIMKICFLLASHIGLINNRLFLYVQCVFIDFFLRCLSSISD
WFSACVAIERAANILKGIHFDKSKSKQMSKWIIFIVTLLTISSYIYDPLNRYLIDEEEEE
EEEKRTWCVNKYSSSIQILDWIINIFHFLVPFSINCISALTIIISAALTRSNCQKKKLFK
EHLMEQIKQHKHLLISPLILVALSLPRLIISLLSGCMKSARESWLYFIGYFISFIPSMMT
FTVFVLPSQMYREQFTQSIQRIWQR
Download sequence
Identical sequences GSADVT00063245001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]