SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00063766001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00063766001
Domain Number 1 Region: 1212-1516
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.87e-18
Family Rhodopsin-like 0.014
Further Details:      
 
Domain Number 2 Region: 958-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000648
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 173-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 4 Region: 215-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000912
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00063766001
Sequence length 1522
Comment pep supercontig:AMS_PRJEB1171_v1:HG381441:45086:49726:1 gene:GSADVG00063766001 transcript:GSADVT00063766001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFYILIIVGQIERLIQGQFNLYNTDNNKDRYCLLYYLHEEYLNYDLRYVVTHQIISYC
LRSLDGNISNFELNYTNKYDISFTFTELQQQNITSQQLFSWSASIDLAERYEMFLNNITN
SLFDNETLFYNCTLSSFGPFCRFTFDLEDEISFDEIVEFYFNRTDPITKDINTTCYIHLK
CNTSMLCLDWREICDRKFDCLDGSDEINCWQLELNECTLDEYRCHNGQCIPKEFFHDISL
NPDCLDQSDEGFPIDSSRCYSDPTFRCEEQTCRSGMEEFPCGDGQCVVGAYSLDQCKNGR
GMFLLDDACSLSVACLISIRSQFCYEWCDTFCPDGDCVKDNCLSLHEFSYGPILAGYARF
LIINKDLQTKSYTNFLPHYICYNETNFVDFRSAKEHLNNSNCRRFDPNELDVESMGQSFS
FEVNLRNMFRAYFLGLSDIYHCNHSMMYQCNNSIKCISIHRLRDTIQDCPFNDDETFDGS
CSLSDAYRRYACVVDGSKVCFSPLIIKNGIDDCTDGVDEREENVVLKHDYIYFQKICDGI
EELLPIFIDGRYETDETECEHWLCNNTYTRCDQFWSCQNGADEVNCLPLTCANFEHPCIF
PNDTSKISCLPITQAGNGIMDCLGGSDEPYHCHSLYPKQEEFRFACSDYSNCLAIIELCD
NIGDCSFDDDEIFCTTYEGQTYERSEKETIYFILRNIPNYFLRLTMKVDFPKLPPIQTIT
SSIRRIPIFRTEMINVLYCNRGILFYNRMTDDTQELHCLCPPSYYGDTCQYQNQRVSLTI
QIRATSDWQQLFTFIIILMDVEGNIESHDFIEYLAIRDCVTKFNIYLLYSSRPKNSSKIY
SIRIDAYLKTKLTYRASWMFPLQFTFLPVHRLSTILTIPYSNIQPLDKCTPSCIHGQCFP
YINNQSLTFCQCNSNWSGFQCMIEKKCDCAYGSLCIDSSICVCPLNRFGPRCYLISSSCH
FNSCINDGQCVPIDERYKLLNQKKSTCICPFGYTGVNCEYQLNQTQIEISFDNDIPISSS
LLIHFITVEPNALPIFRSVMKKIAFYESILVFSITFSFHISFAKIFNNYYLIILREEIIT
AANISTRILPSYRCASIYELFNSTLANQHLLKRIKYYHQPCQKRQELICFYDEIHFCLCD
LDRQANCFEFNHNMTYDCYGYNFCENRGQCFQDDKKCPKSAICSCPECYYGSRCQFSTIG
STLSLDVILGYQIYPNMSISQQPIVIKITIILFVIMFCLGFLSNIFSLITFQRETTRNVG
CGLYLFISSIISMIIMIIFTIKFWFLLIFQIGLINNRLFMFIQCVSIDFLLRLFLSFGDW
LSACVAIERAVNVSKGIKFDKVKSKKIAKWIILFVFILTICSYIHDPNHRHLIDDDEEHR
IWCMTKYSSSLQIFDWTMNLLHFLVPFLINFISALIIIINATRIRSNVHKKQSRKKILHK
QFQQHKHLLITPIILILLAFPRLIISFLFGCMKSARNPWLYLTGYFISFIPSMMIFIVFV
LPSRVYRDEFTQSIKRILDKII
Download sequence
Identical sequences GSADVT00063766001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]