SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00064159001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00064159001
Domain Number 1 Region: 70-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-32
Family MAM domain 0.0038
Further Details:      
 
Domain Number 2 Region: 31-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00064159001
Sequence length 203
Comment pep supercontig:AMS_PRJEB1171_v1:HG387874:53:799:1 gene:GSADVG00064159001 transcript:GSADVT00064159001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIGVDDISFTPSCTLQTQSTLPTTVPPVTGTPPCNATHSQCLTTTSQCIPNDAFCNFYID
CKDQTDELACPLACNFEQKSLCQWTNDKKQKLQWDFGSGNTASSDTGPSYDHTTHSINGT
YIYLETSTGFTGDSARLISPLYRKSSKTCMFTFWYHMFGATIDTLNIHIRAGGMDALIWS
LKGSQGKDWLQGIAYLPTCSITI
Download sequence
Identical sequences GSADVT00064159001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]