SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00064999001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00064999001
Domain Number 1 Region: 1115-1422
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000851
Family Rhodopsin-like 0.017
Further Details:      
 
Domain Number 2 Region: 860-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 100-136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000766
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00064999001
Sequence length 1426
Comment pep supercontig:AMS_PRJEB1171_v1:HG381490:31716:36237:-1 gene:GSADVG00064999001 transcript:GSADVT00064999001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNNDSEFFYNCSSPWFGSKCQYQFIFNESFSFNKIVQKFVSDRKKISLNVSITTCYGLL
NNCPRGPWSLCLDWRQICDGKSDCISGEDEQWCEILETSTCNDDEYRCHYGGQCIPKIFL
RDNEASTDCLDGSDEVLPEPRLSSYSQVNNKASTDHLDGSDESLLLRSSLASYSQAIPCG
DLIIFRCDERISRYPFSFPCGNEEFIGIRPIPINGRFYCELLSEYCSDEWLVLPEYPIMY
GFFQFIYLTNRSINEFKNNVMPDFICFDAKNCPMLLSKIIPIKIIDNLTCCHTLDLPNAY
ETKHFHDINEFFDETYSACVFIGNVMSCENSSYFYCNQSQKCISYNRVGDGFQDCSFNED
EDFPSCQLNDSNRFRCPSNPDKCLLPVAIRDLLDDCSTNELLENQHGIVRKISFPSLCDR
IPNDEILQIAENETDETNCHLWPCDNPYSHCNGYWDCLNGIDELYCNKTNCSFNEFQCKN
EDLKLTYCLPFNHLFIKPKDNCRWNNYFIELYFDNGTQDLSQYYYSFNKSKCINKDNICI
SHMKKVNLQEDICYQSPDIIVSFLSEVIKIDNDHHTLLCRMDQEVSANYMENRFMTTLNL
GYFPEITSIIPHENISNINEEKEIISRIDPSLAWYCHYGIPLFYGNKNKTKVCLCPPNYY
GSRCQWQNQRISLTIQIKTHLNIPLLSIFQFIIMLIDEQGNITSNNYEQILYMPDQKCNS
KFNIYLLYPNRPKYLSSNYSIRIDLYNKSRLDYWSSWILPIPYQFLPVNRIATQLMIPKF
RQNHLCNFSCGEYGQCIRYINLNNSFFCQCNRGYTGRYCHIKQSCQCSLDSLCISSSICL
CPLNKFGTYCYVDRFICQLNNNPCENNGLCIPTDDRINYNGFICICKEGYHGKQCQYKNN
LIHINFNYKIRNNNSLLFIHYIKAFDQEIEHQRITILKKILYGYNSITIYVKQSFNIIFI
QTFGDNNYYLIVLREIYFLLESSINVNLLPKQHCLSVKNHLNKTFYEYKYLHRIKYYPYL
CQQNRELMCFYDEYHLCICDTKRFSNCFLFNHTLKYDCHENNLCSNDGQCFQNNQTCPTT
FTCLCSDCYYGNQCQFTTKGFLFSLDPILAYHIKPNISINQQPFIIKFSIFITTILLLFG
LILSSLSLITFQSEKTKEIGCGYYLLTSSIGSICMILILKIKFWLLILIQMSTINNKTIL
LMNCISIEIFLKSLLASTEWINACVSTERLFTVIKDVKFNKKQSQIWSKRIISTIILLTI
LTHIHDPIKRELIYDIDGDQQRIWCITKYSSQLTTYNTFITLFHFLMPFSINFLSALLLI
IIVARKRSNIKHELTYKQHLQSQLKQHKYILIAPVTLILLNLPRLIISFASGCMKSPENS
WLYLIGYFVSFIPPISTFFVFVLPSKAYKSEFDKTIQQWIRRIQRG
Download sequence
Identical sequences GSADVT00064999001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]