SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00066733001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00066733001
Domain Number 1 Region: 9-444
Classification Level Classification E-value
Superfamily Sema domain 1.57e-83
Family Sema domain 0.0000045
Further Details:      
 
Domain Number 2 Region: 545-595
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000124
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 3 Region: 607-653
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 493-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 440-476
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000471
Family Plexin repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 726-768
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000126
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00066733001
Sequence length 996
Comment pep supercontig:AMS_PRJEB1171_v1:HG381591:19349:23617:1 gene:GSADVG00066733001 transcript:GSADVT00066733001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRNIQIYQESDNTFDAIIIDPQRDQILIGAKNSILRLSINDFHLLEKFQWKSSTTDIST
CRNQIQSHNECENYIRVLALRSRDQLLLTCGTNSYRPICTWRRPDSLSTIIPNDNFLSGD
GKSPYNSQFPTAYELIETGELYSATSNEPVFGVNDPLIQRSFTEGKQLRTQQHDSNWLRN
PYFVRILNIGSYVYTFFREIALEHLSCGTTVYSRIARVCKHDDGTMKFSDTFRSFSKLRL
SCSKKIANEITSFDYNELQSIFFDRSTNLIYGAFNLPKSGLPGSAICIYTVDQLERVFTS
PYLTQKSNESYWLPSSSKHESEKCEPHQSSEIPIPSGPVLRSGVLQSSFDALVLENIRIG
QLLIDRFNGITILFVITFDGLQLRKYSLINNNLCLLEQIQLKPSTLSENQWKINQVELIS
ERKELVLTTTVSVLKFSVARCDRFNTSNLCLSAMDPYCTWDSNQQQCILYTKSSSTFTSS
SRSLTCPILNTTIDGGWTSWSSWFTCEQITGEKCQCRTRTCTQPMPQFGGRLCQGSNVEI
TRCEVHGGWSPWNEWSLCPKTCGKTIRTRTRTCTNPEPKNNGRLCIGSEREEESCPEILC
SDESARLSSWSDWETCSKSCGSGIQKRRRTCLLHGNKCTECLEETRLCNESPCPIQQVTL
WSDWSQIVNPSNEGVYTEKRTRFICAIGTSFDKQLPEIKSDSIMYRICSTRGGNDCQETE
NLHFDDWSPWSAWSDCYPSCGIPSAVETRRRTCLGKRCVGNDIEKRECLSCLSSSNNNWS
CWTDWSDCSLCTSTRLRSIKTRTRTCLTNSCQGDSHEERLCSKCPLSSKSFSIIDSFNEN
RFTLIHLILISLISFLLACFIMLCIFVLCRRRCRHQHYRHRQASNTFLHTDDRDYFQAST
SNSSSSPHTAQDSDTFTTLSTTNNHTSKFRSFDSSSSSTTTGGGGSGVSAFLKEIPSRKL
NMYINPREMPPLPPAATLKRTSLMSSMKTNLDADDL
Download sequence
Identical sequences GSADVT00066733001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]