SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00067138001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00067138001
Domain Number 1 Region: 1164-1466
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000174
Family Rhodopsin-like 0.0097
Further Details:      
 
Domain Number 2 Region: 408-448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 924-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000692
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00067138001
Sequence length 1472
Comment pep supercontig:AMS_PRJEB1171_v1:HG381625:23403:27873:-1 gene:GSADVG00067138001 transcript:GSADVT00067138001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRSDEYFDNYEKQCPFTPNAIQCDEHLCHINQYSCGDGECVEWITRMAFQRIAEAKTDC
YTKRNLNYMCEASPHRQAWTLKNGLCWPDEGYDDPRYPPWNMINVSNLTNGEKCEYLFRC
LMSDNFECDCPCRHLNCAQMMINVCSDNRDFIYPPRGLINDNVITIYNYHEYKRNTNFHL
FKLGNNVKCQGYLSEARTLIGHAAIVGMILFPLANQLLCLLDAGYVYQNFSSPFQYDKYC
WNESLTFNGRPYAVIPHVCSSSTQCISQYRIHDGSDDCMQGEDERIILMNGSCTGNVGRQ
RFQCYNDQHKCLGADKLGIGYAHCSNSYDESWFGNDLPLQTDLLCLNGITTNCHRVKDYI
RHSSDQNSTRKYSHNHFQLPKRTGRIPFPSYCDSVWDSDTHMDELSSSCQHWICPSDQYQ
CQTGQCIKLEWLCDGEWDCADASDEQAVVLIRQWSTHNTRLSGLSVQLDQCRQRYFRSPF
SDSCNTSFEFGCLRSKVPNPLDIRANHPCINLTQIGDNVEDCYNAYDEKNTFTAQTVTGG
MWGFHFRCEDKHKEYLYSCHEEHTDDCNIDILCSKYRDLNGSCSDKNDFICFDDHQCKKN
ARCNGQFDCSHGEDEYWCVYGTLYSRQKYRRNKLEIYASRNLNRALIQYPKEPIMTTNEQ
QLTTPIVHPPRDHRLTNYSFICNRGITVLQSNGIRCLCPPSYYGHRCQFFSDRLTVIAHL
NRTTLPNFLSNTTLKMQAKYLFNNTIIDQHEFDLIPTLETSNIIKHQFYLLYSRSSTMIE
HKRNRYFNRIDIIINHPYSLHFLVFALHHQHNQPEQLATWNYPIYFDYLPAFRLALVLKF
PSSFQHPQPSNHCNAHSVSLPVLNQNNTFSCSCRSGYYGVSCSLYEPLCHTYCAPNAFCQ
SNEGRKPHCVCSLGHFGTRCHLKYDQCDQHFCLNNGTCHQSYDPSDERPFVCICSKTFNG
TRCEHEIPLVSGGSNMTSRYGYRATVVQFYHIAIPLFALYIQHQKVYEGYPSMITYYQDS
AMMPPIGLLKTYQDSEAPQYFIMYVLGESVINVVPSPCHCPHASSLLLTNAGESSPLVFR
YHQICQNDTERVCFYDENYLCFCRSNDLRAECFIHNTKLDRCDKCLAGGKCLQGNPTDVN
DFLCLCSSCHQGHRCQFNLQAFGSTFDSLVVRFPTSTRIAYFCVVFLLVIVGLFNNSCSF
ITFKRPTPRKFGTGTYLLFVTCLSQLALLCLLIKFIQVTFAVSSLISCRLTSYLLSVLTR
STYWLTSWVTVSRVLVILFPNSSLVKDASVAIIMSVVTLLIVLVMHIHEVIYYTIIDDHR
TNLASCVIDLSTDFVSVYNRLSTPVHYIVPFLIQTICITLVIVFATRSRTRATRQKITFY
ETLKAQFRSQKELYITPVLVIFSVLPQLIVTFSLACRDLSGGQRHVLMCAYLLSYALQVV
GFVLYVLPSTTYRKEFDNTWMGKKLSRWIYKK
Download sequence
Identical sequences GSADVT00067138001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]