SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00067301001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00067301001
Domain Number 1 Region: 155-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 2 Region: 56-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000107
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00067301001
Sequence length 196
Comment pep supercontig:AMS_PRJEB1171_v1:HG381641:3342:4090:1 gene:GSADVG00067301001 transcript:GSADVT00067301001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKFISIFALLISFIAFSYVNAAEKILMDKICGSDAMVLDGNIKPGLAFQLSNINKFQPN
FNCSIKFRTALPTQRLVIVVEQMNIADCPGDTLRIYDGTTLLNKDIRQQCGAPTAFTFTT
TSTQTTFTFATGKTTKTASFQIAIALHFTTVPGCPQNLGVFLCKNKNCISKSLTCNKHNH
CGDATDELNCSIIGKK
Download sequence
Identical sequences GSADVT00067301001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]