SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00000496001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00000496001
Domain Number 1 Region: 95-176
Classification Level Classification E-value
Superfamily HMG-box 0.000000268
Family HMG-box 0.0035
Further Details:      
 
Domain Number 2 Region: 336-411
Classification Level Classification E-value
Superfamily HMG-box 0.000000484
Family HMG-box 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00000496001
Sequence length 483
Comment pep supercontig:AMS_PRJEB1171_v1:HG380759:332885:334631:1 gene:GSADVG00000496001 transcript:GSADVT00000496001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGSRPKPSSNLISDKILVGIKSYRPLRLFITKQKKKGSTENPFTLRVKYCQLPQEKQD
RFLQKAVDKYIELLDEKDVDEQVQIDCKLFDYLLMKGEQKKYFQSINAPIKPPGTAVPFY
TQNVKEENDDDTEISWKSLSTDERKVFKRKRKEAKLEYAAQVKNFANDLPERLRTDYLIY
AEQYPHKRPKIESTIVHTDESQLIRQRRKSLTALPESLQTPTAAVFSPLSDDIPVKLNRN
QLESLHKCMPNVLYYENAVSNDDKPTFTRTMTKNSYMKSIFSQLDDKERLKYVTKSIKKW
NEFLEENPLIIEYLIPTLHLLLTRQEDIMLYFSSIDLPPRPPINSYLYFNLEKEETGSRQ
SWSDLSPTQKTEYAEQLTARKNEYYQKLTHFVDDILPSDYMRYEFFRNIKYAIKDYELAT
KSEILDKQTGQIKWHEYYMQKLSLQNQQNQINHIKEKLLATGLTTEQKDLVDELIQIYCG
CTK
Download sequence
Identical sequences GSADVT00000496001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]