SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00002724001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00002724001
Domain Number 1 Region: 256-496
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-57
Family Voltage-gated potassium channels 0.00055
Further Details:      
 
Domain Number 2 Region: 91-210
Classification Level Classification E-value
Superfamily POZ domain 2.56e-31
Family Tetramerization domain of potassium channels 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00002724001
Sequence length 1011
Comment pep supercontig:AMS_PRJEB1171_v1:HG380765:365738:370964:1 gene:GSADVG00002724001 transcript:GSADVT00002724001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTINSTSHHSEDISHLSKANLWSNNTILPIANPTAAAALVQDNEMAIYDERQMKSSRSS
PLGTPKASERTHRSPTDCSTNLYLSTLNTSRKVILNVGGVRHEILWRTLSRLPNTRLGRL
AKLRKISLHSTRSMPHDEIMRLCDDYDSATGEYFFDRHPRSFSSVINFYRTGKLHLVDDI
CVISFHDELNYWGIDEYYLELCCQNRYHQKKDHVLEEMKKEADLLKVEKEDKATGDRWCE
HTRRKIWDLVEHPHTSKAARVIAFVSISFILLSSFTLTLSTIEATARDLHNEHHDSTSEC
REPLSLFIIETVCITWFTIEYVIRVFTTPDRCKFFKGVLNTIDLIAIVPFYVSVALETLD
TGHFKNIKSVRKAVQIFRVLRIMRILKLARHSTGLQSLGYTLKRSYKELSMLLMFLAIFI
LLFSSLAYFAEREHNAIQFRSIPHAFWWASITMTTVGYGDIYPKSVWGKLIGAVCCVCGV
LVIALPIPIIVNNFAEYYKEQLRREKALKRKEAIDRAKKNGSILSIPAESISNLFHMEFN
ARRLSGWKNSTYPLTTPDEPIYDPGCYEKKTSETSLLHNPHTVDLYPNTNENNHRRITTT
NEEPDIDAKEMLVKKENNENVCFFFRSSRFDVYATLRHYCGFSRNDDDFVDRLSRYYSVL
IFSVFVVIVSSVQFVGKPISCFTPASFTDAHITYADFICWISDTYYLSIDAEIPDPEDLE
ARQGTNAIRFYQYVPFILLLQAFGFFLPGFLWRSGSFRLGICLQKHIDQLDMSRRSLTEP
PIYRRQLIRNVALRLDQYFRMRRRSSIPKLTFLYLLIKIFFIVNILIQLTCLHYLMNFDF
TFDSLFQRLIIYSTTIRHTSLQFPTNVLCDFIVRFLGKNKHRHTVQCVLPINVFNEKIFL
FAYLWLIFLFICAIYNLLFQWIIFILFHRRVRDTRGRRLRHISSKHHCDDIFQENELVHR
IDYQPITKNFSQRYLRCDGIVIMRLFDMNIDLVTMNDLMNDLWELYKVNPL
Download sequence
Identical sequences GSADVT00002724001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]