SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00006553001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00006553001
Domain Number 1 Region: 225-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-82
Family Protein kinases, catalytic subunit 0.0000000193
Further Details:      
 
Domain Number 2 Region: 121-264
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-36
Family SH2 domain 0.0000431
Further Details:      
 
Domain Number 3 Region: 60-170
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-24
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00006553001
Sequence length 511
Comment pep supercontig:AMS_PRJEB1171_v1:HG380778:603444:605768:-1 gene:GSADVG00006553001 transcript:GSADVT00006553001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCWFSKGNISQPLAELNDIHLQITNKSKDGPISSENQIIKSHINGNDINRQKNICATDK
VYVAIYDYDARTDEDLTFRVGDLLIILDDSQNDWWLAKHYSSGLKGYIPALYVAPHGGLD
VNEWFHKNVLRKEAERLLLIPSNPRGTFLVRQSENAPGPYSLSVRDVDEQRGPHVKHYKI
RYPDPKIGFYIATRRAFKSLEELIDHYTKNSDGLCCQLTLACPRPKPTTSTISKDVWEVP
RNSLQFIKKLGQGMFGEVWAGKWNNKIDVAIKTMKAGTMSTEAFVDEANIMKKLRHDKLV
QLYAVCTEPEDQPIYIVTELMGNGSLLDYLRDGSGRDLKLATLVDMAAQIAFGMAYLEHE
HYIHRDLAARNVLVGENGVVKIADFGLARIINEDQYVAKAGAKFPIKWTAPEAAIYGKFT
IKSDVWSYGILLYELVTHGQVPYPGMANREVLDQIQRGYRMPRHENCPDKIYDYMLRCWD
SSPDNRPTFEHLHLFFDDYTASAGPQYHSQN
Download sequence
Identical sequences GSADVT00006553001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]