SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00006836001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00006836001
Domain Number 1 Region: 330-601
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-82
Family Protein kinases, catalytic subunit 0.0000000451
Further Details:      
 
Domain Number 2 Region: 228-372
Classification Level Classification E-value
Superfamily SH2 domain 3.27e-37
Family SH2 domain 0.0000457
Further Details:      
 
Domain Number 3 Region: 169-250
Classification Level Classification E-value
Superfamily SH3-domain 3.07e-20
Family SH3-domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00006836001
Sequence length 618
Comment pep supercontig:AMS_PRJEB1171_v1:HG380779:669499:671965:-1 gene:GSADVG00006836001 transcript:GSADVT00006836001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPYKSRVQQLLQGGLRSTKNYLAERVDARLIVGQAQRNVRDFARKAEQRLQEATGRKE
QQDRDMGNCVYSDRPTSTKIQQNQVPDSIHNRSNLRSPPVNSPVVLPILIQPPTISAPGS
PVSTPTPSARQKSTLNHIAIRTPSSSGVSSASSSTTSAVIPKSPIDNHRFQFIAIFDYDA
RTKEDLTIRKSDILEIISRKNAAWWMARNENGHEGWIPSNHIAKRGSLEAEPWYFKSIRR
IDAEKQLMSDVNDHGSFLIRDSETRRTDFSLSVRDYDSIKHYRIRQGEPDGQFYIARRIT
FNSLPDLVSHYSRFSDGLCVNLRKPCVHIVKPEPDGLSHNLVDKWEIDRNDLKTIRRLGN
GQFGDVWEGLWNNRMSVAIKTLKPGSMNPTDFLAEAQIMKQLKHPNLIQLYAVCTLKEPI
YIVTELMQNGSLLDYLQGTRGRQLKISVLIYIATQVARGMAYLEQQNYIHRDLAARNVLV
GENNTVKIADFGLARIIKEYAGGMYEAKEGTKFPIKWTAPEAALYNRFTIKSDVWSYGVL
LTELVTYGRTPYPGMTNAEVLRQVEHGYRLPQPPNCPSSLYAIMRECWHAQPENRPSFVA
LQYRLENEYTGENPEFSN
Download sequence
Identical sequences GSADVT00006836001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]