SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00010730001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00010730001
Domain Number 1 Region: 105-546
Classification Level Classification E-value
Superfamily Sema domain 6.41e-80
Family Sema domain 0.00000564
Further Details:      
 
Domain Number 2 Region: 634-684
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000458
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 3 Region: 696-742
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 542-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000173
Family Plexin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00010730001
Sequence length 744
Comment pep supercontig:AMS_PRJEB1171_v1:HG380796:599892:602700:-1 gene:GSADVG00010730001 transcript:GSADVT00010730001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFALGRRTEREEKEISLHSQSIMFISLWYIKKMHIYIFRLSKKKQNSVMIVLYLFIFN
IYSIIANDILDFRFISYNGNLYRNIHIESKGSNLSYILESLQNLAIYQNGDEAFDAIVID
EQRNQIIVGAKNAIIRLSIDDLHIVERFIWESTPNEINICRKQIISTHECENYIRVLALR
SSDHSLLTCGTNAYHPICTWRQPDSLSTLTSNENFLPGDGKSPFNSQYSSVYNLIDTGEL
YSATSNEPLFGIHDPLIQRSFSQTKQLRTQQHDSNWLKNPYFVRILNIREYIYIFFREIS
LEHLSCGMNIYSRVARVCKYDDGTMKYSDTFRSFSKLRIQCAKKSMNEMISFDFNELQSI
SFDSSLNLIYAAFNLPKNGPIGSAICIYTTDQLETVFKSPFLTQKSNESYWLPSSRMSQV
PEKCDSSQSNNESMIPSGPVLRSSVLQSSLDALIFDDIRIGHLLIDRFNDITILFVISLD
GLWLRKYSLLSDQKLCLLEQIDLKPPMILSENWKINKAELISKTKEIIITTQISVLKISV
VRCNRFTTEEICSASMDPYCIWNTSQQRCILTNIISRPSLTCPNINITIDGGWSSWFSCE
QETGEKCQCRTRTYSQRNGKLCQGNHVEISQCQIHGGWSPWSSWSQCPQLCGKVLRSRTR
TCTNPSPRNHGRICIGLEREEEFCPEIICSSDSSRLSVWSEWDECSKSCGNGIQKRRRTC
LSNNESCNECLEETRVCNESPCPG
Download sequence
Identical sequences GSADVT00010730001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]