SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00018918001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00018918001
Domain Number 1 Region: 202-288
Classification Level Classification E-value
Superfamily SH2 domain 5.5e-39
Family SH2 domain 0.0000185
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.31e-36
Family N-terminal domain of cbl (N-cbl) 0.0000212
Further Details:      
 
Domain Number 3 Region: 116-201
Classification Level Classification E-value
Superfamily EF-hand 1.49e-31
Family EF-hand modules in multidomain proteins 0.0001
Further Details:      
 
Domain Number 4 Region: 296-376
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-30
Family RING finger domain, C3HC4 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00018918001
Sequence length 609
Comment pep supercontig:AMS_PRJEB1171_v1:HG380840:428887:431278:1 gene:GSADVG00018918001 transcript:GSADVT00018918001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRIVKYCQMPKMNLKNSPPYMLDILPDLYQTLREILNNYDDRLHILNDIEYFRIFIDNL
IEQCTKTIDCFKRAGHHMYDEQSTHRKYLTKLSLYFSHNLAELKSLFNRGIYEGEKFRLT
KQEATDFWKSNFNERTIVPWEEFKEKLNRIHPIHTINETTALQNTIDLTNNNHVSIFEFD
VFTRLFHPWSSLLTNWKLLAVTHPGFMAFMTYDEVKAILTDYIDKPGSYVFRLSCTRLGQ
WAIGYVTTQNTILQTIPQTKPLIQSLIDGEREGYYKYPNGKNIHIDLSSALRPTESDRIL
VSEEQYAIYCDMGTCFELCKICSVNNKDCKIQPCGHLICQSCLIAWQNQNSAKPPPLCPF
CRGEIKGFESVVISPFDSAATANKKESSPNGSNEFDDTNGTSIISDNTSSTPPPIPPRPV
NIKTNGTRVSNDVIPKGTLQQRFQQFSSPVIPPPLHNNDVLLLPQRSFAKTQRPLSSASS
SESLNDSLALLSTVSTDQTQTRPVTLQNSTDNHTRAINHTTSPIPDSISNNIEQLRTIDD
IRSRLIEEFNQLEQTRIDAALTLTNGLSLIKQYELSKSFLTQVQYEQISNHNNNTNHTFI
NESFINEFD
Download sequence
Identical sequences GSADVT00018918001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]