SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00020398001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00020398001
Domain Number 1 Region: 289-548
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.59e-78
Family Protein kinases, catalytic subunit 0.00000046
Further Details:      
 
Domain Number 2 Region: 141-269
Classification Level Classification E-value
Superfamily SH2 domain 1.57e-34
Family SH2 domain 0.0000858
Further Details:      
 
Domain Number 3 Region: 95-163
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000336
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00020398001
Sequence length 557
Comment pep supercontig:AMS_PRJEB1171_v1:HG380850:176619:179251:-1 gene:GSADVG00020398001 transcript:GSADVT00020398001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRSGSSRSKSRESKYKYPDNYPNNVGTHKHSGGSTNQRSYSSQINGYTQHSAHPYQNS
YGVPSITNTQSQYIPNQSQQQLQQHHHSNNNNNNNTNPKSNPNKIIYVANYDFNGTSTTG
ELSFVKGDRLEILDRYTYNDWWQAKNLRTKQMGYVPANYISPLNDLTAYEWYFTETNRRD
AERFLEQPHNGKGTFLIRPSDTNQGQESLSVLDLSKDKHFHVKHYRIRRTNQGMYYISSK
TLFSNLQELVDHYQINIDGLCCLLTRPCRKIEPTVPADRHGLLELDRLQLTRTDLLGKGN
YGEVYKGKYGQRDVAIKYMKTDNKNRLYNVDKFLDEAKIMKDLLHKNIVRLYGVFTQEEP
IFIVTEFMINGCLLNYLRDGQGKNIKFKTVLDFAAQIANGMAYLEQKRYVHCDLAARNIL
VGELDVVKIADFGLAKILQGGRLLVDRESQFPIKWTAPEAATKKEYTTKSDVWSFGILLY
ELITHGSNPYPGMSNNEALQAVLSGYRMPKPNDCHELYYQIMCSCWQENPDNRPTFETLY
MRFDEFMIQAEPSYRET
Download sequence
Identical sequences GSADVT00020398001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]