SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00021019001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00021019001
Domain Number 1 Region: 5-247
Classification Level Classification E-value
Superfamily SIS domain 0.000000000000262
Family mono-SIS domain 0.00078
Further Details:      
 
Domain Number 2 Region: 397-484
Classification Level Classification E-value
Superfamily SIS domain 0.0000000142
Family mono-SIS domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00021019001
Sequence length 561
Comment pep supercontig:AMS_PRJEB1171_v1:HG380854:308657:311054:1 gene:GSADVG00021019001 transcript:GSADVT00021019001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVPYTERRNPKTMNVDMDTPEGIVDLLHECNMEVFNGYENHKGLSDEEILNKLDQFVS
LVRATLQNEKGVIVISGCGTSGRIGFLACTFFNQICRQQNLPDKYRYIIAGGNSALVTSI
EACEDDPILGAKELKDITESYEHVLFVGITCGLSAPFVGGQLEYCLDNQKKFTPILIGFN
PISMARRICVPKWPNNRTFHDIASRMEANQGVLVINPIVGPEPISGSSRMKGGTATKVIL
DTVFYLASTNTTSKASDMIEIYKNAVDTMEIAGNDLASIVEQAGECLKNNACIRYVGSST
FGIWGMIDASECVPTYNSAYNDIRGFMANDYFKRNLNPGPPNSFISPALHEATPDDLSKT
FEDLPSSSLVVFIDTEFHSQKTLVQKLQEKGHRIAWIKLLSIESFDSNSKVQLADFSVCI
PSSDTTMRYCLAELILKLSLNTISTGAHIMKGKVFQNIMIDVRVSNIKLFYRAIDIIKSL
TGVDQEIAERSLIQSIHQTNDKVTDKTTEDHIFAVANNSDHIVPIALFMCLSKCSYTQAK
NEIDKCPIIRDICTHTGRSSQ
Download sequence
Identical sequences GSADVT00021019001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]