SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00022458001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00022458001
Domain Number 1 Region: 79-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000788
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000518
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00022458001
Sequence length 162
Comment pep supercontig:AMS_PRJEB1171_v1:HG391401:2:659:1 gene:GSADVG00022458001 transcript:GSADVT00022458001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHLCSNGGTCVSLSNGASYKCACPAGYTGDLCQNSILNQCVSQPCGNAGTCVQGPFTYDC
KCRSPYRGKQCETIATVSSPCDSNPCNNGGTCNAVGNSYTCACPPGYTGNTCELNIRPAV
CELNCSPGYCFANPSGQPSFACYCTDNTIHLRTCSTRSASRP
Download sequence
Identical sequences GSADVT00022458001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]