SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00028075001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00028075001
Domain Number 1 Region: 31-427
Classification Level Classification E-value
Superfamily Ras GEF 2.09e-81
Family Ras GEF 0.00057
Further Details:      
 
Domain Number 2 Region: 532-604
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 471-554
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000118
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00028075001
Sequence length 913
Comment pep supercontig:AMS_PRJEB1171_v1:HG380873:275973:279243:-1 gene:GSADVG00028075001 transcript:GSADVT00028075001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSNNSGDVDESNTRSESNETPEYLKEEKPIVPGVHVKGATLNRLIRILVDSFQTNGIV
TDESEFPRVFFLMHKWIMESEYLSHMLYDLYKHTDDDYKKAINSTEKRSYKEYQLRICHA
YNFWMKSFPMHFDLDKKLKETCEQMKELIKVSGDIECMKLVDPTQIPSFDWMRQMTVRNQ
TKNKTVSLGFNNIDPQTLAAQLTYLEWKILRRITFTDYKTYAIKNTLQDNPRLERSIQFF
NGLSTWIQCMVLSKMTPKQRAEVIHKFLDVAKYLKELQNFNTCLAVIGGISHSALARLSK
TMMCLSSEDIKLLGEMTDLLSSNSNYAQYRKSLNDCEGFKIPIIGVHLKDIISLHVALQD
RLEYDLINFRKLVQLSITFRTLTNLQGSVPPVQPNHDLINLLTLSLDLSYTEDEIYELSL
AREPRSSVSSPDQVGRGLQPGDATNESTTDGYKKKEQIHSPVFADWAAGVSQTIDIQTIQ
RHVNAMVEAVFTTYDHDRDGYISHTEFEEIAQNFPFIDTFTVLDADQDGMISKTEMRSYF
LRAKYHDLKGEFKHDFHETTYFKPTFCVHCTGLLWGLIKQGWKCKDCGINAHRHCKDQVV
MECRQKRSNQVNKQSSMGDSRSGRNSFRIRKTRKQKGTQTEDFNFSSTTSSSASSESCTS
SSDDEPPSLPHHSQSWHMHKSSSLKHRKPNLSDSNDDYYYTHPPSPPQNQILNNTPSTNI
IPVAQQLIPRGPLICSDSFEKWNDRCFTWNRPLLPPTLLSSAPSTSTGTSESTTSITTAK
TEINEQDKLNSPLFYGQASFLEGDVSDDDDDTRRFIGPKQIRRNVKATMCKDIGLVTSPT
LDENDDDTCLSTNNSLQPLKTTPNYGSSQNLNSRRLSLTESLHSLPVKSDTTQNEIFQRL
RQAEEVRRFSVVN
Download sequence
Identical sequences GSADVT00028075001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]