SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00029136001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00029136001
Domain Number 1 Region: 105-546
Classification Level Classification E-value
Superfamily Sema domain 6.41e-80
Family Sema domain 0.00000552
Further Details:      
 
Domain Number 2 Region: 634-684
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000262
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 3 Region: 696-742
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000314
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 542-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000068
Family Plexin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00029136001
Sequence length 766
Comment pep supercontig:AMS_PRJEB1171_v1:HG380881:264892:269670:1 gene:GSADVG00029136001 transcript:GSADVT00029136001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFALGRRTEREEKEISLHSQSIMFISLWYIKKMHIYIFRLSKKKQNSVMIVLYLFIFN
IYSIIANDILDFRFISYNGNPYRNIHIEFKGSNLSYILESLQNLAIYQNGDEAFDAIVID
EQRNQIIIGVKNAIIRLSIDDLHIVERFIWESTPDEINICRKQIISTHECENYIRVLALR
SSDHSLLTCGTNAYHPICTWRQPDSLSTLTSNENFLPGDGKSPFNSQYSSVYNLIDTGEL
YSATSNEPLFGIHDPLIQRSFSQTKQLRTQQHDSNWLKNPYFVRILNIREYIYIFFREIS
LEHLSCGMNIYSRVARVCKYDDGTMKYSDTFRSFSKLRIQCAKKSMNEMISFDFNELQSI
SFDSSLNLIYAAFNLPKNGPIGSAICIYTTDQLETVFKSPFLTQKSNESYWLPSSRMSQE
PEKCDSSQSNNESMIPSGPVLRSGVLQSSLDALIFDDIRIGHLLIDRFNDITVLFVITLD
GLWLRKYSLLSDQKLCLLEQIDLKPPMILSENWKINKAELISKTKEIIITTQISVLKISV
VRCNRFTTEEICSASMDPYCIWNTSQQRCILSNTTSRPSLTCPNINITIDGGWSSWFSCE
QETGEKCQCRTRTCSQRNEKLCQGNHLEISQCQIHGGWSPWSSWSQCPRLCGKVLRSRTR
TCTNPSPRNHGRICIGPEREEEFCPEIICSSDSSRLSVWSEWDECSKSCGNGIQKRRRTC
LSNNESCNECLEETRVCNESPCPERKYDNDRDKKKRTVHIVHFDLP
Download sequence
Identical sequences GSADVT00029136001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]