SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00029414001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00029414001
Domain Number 1 Region: 745-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 2 Region: 851-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family Laminin-type module 0.0023
Further Details:      
 
Domain Number 3 Region: 959-1001
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 4 Region: 315-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000023
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 5 Region: 904-956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 6 Region: 1007-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 431-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 478-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 9 Region: 374-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 10 Region: 805-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family Laminin-type module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00029414001
Sequence length 1212
Comment pep supercontig:AMS_PRJEB1171_v1:HG380884:35044:39770:-1 gene:GSADVG00029414001 transcript:GSADVT00029414001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVCSVFTITRTFFFLCLIILGEFSNVSAQKSRSNSKSASNRAIPKKTTTKKPLEILTPP
PIVIEEQTCYNKSTGDAIRCLPEFINAAFRRPVNASNTCGERPPQSALFDDYLSGNEQKN
CLVCDSRDSPRAHPPDYMTDFNQRGNLTWWQSETMLEGINYPQTVNLTLDLGKTYDVTYI
KLTFQSPKPESFVIYKRTNENSSWIPYQYYSASCMLTFGLPAKKYPDFDTEAICSEDFSD
LTPLHGSEVAFGTLDWRPGAITFEMRNDLQDWITASQIRIQLVRMNTFGDEMFGQPAVLR
TYFYAISDLAVGGRCHCNGHANKCTKKGGEHKNETRCECEHNTIGRDCDTCHPAYNDAPW
KPAGVLDAHPCKACVCNGYAKNCTFNRELFERTGHGSVCIDCAGNRGGPNCESCKLGFYR
LPESEGECSACGCDPIGSESVQCATDGRCRCKPGVIGDKCNQCAPYHYNFGPNGCARCTC
YEAGASQPLQCNPKTGQCSCKTFVEGQNCDKCRSGYFNLDPTNPDGCTKCFCYGHASTCQ
SASNYYFNPIRSSFSQGTDGWRAVNQTGHAASVYSDTGSYIYVQPLPGQDLTFEAPARYL
GDRTLSYNQFLTFILILRANGVKVGVVIYGGVQQTIPSEEPLTFRYRLNEQSWSPTLSFL
EFMRLLSNVTAIRIHATFGIDNAVSFLGEISLGHSTPSAGLFPVGNVETCSPCPQGYYGE
RCEYCAIGYRREPSFGGPFASCVPCDCHNHSFSCDVETGRCACQHHTTGDNCERCLPGYY
GEALRGTPDDCQKCPCPAGVSCTQLSLPGQHVVCLNCPAGYTGDRCEYCDDGYFGDPEGL
VTGVRRPCELCSCSGNIDTNTINNCNTTTGHCLRCTRNTYGVYCEKCLPGHWGDALLDIK
CHACNCHPKGTQRHSDNSLVQCNLQTGHCPCKSNVQGRQCDRCENGYWNLNSDRGCETCK
CNPIGAYNISCSVNTGQCFCKPGVTGQYCDRCLPNHYGFSSSGCSACSCDQYGSLDVQCD
IVTGQCPCKENFMGQRCDLCEENKYRDGFECPNCPPCYREVQKRVNRYRRDLNLLQNAIS
TLNSSQTLNNFREDKRLTSELDGLAQNLNDLQIDLQRKIFKFVFFQHLYIYIYLKCFLLL
GAGLIYRNTTDYDQQDAQFKMNVTEFEGRYRRLERELPEFIAQNDRIRDILQKANDTFLN
DTTYQLSMRIIV
Download sequence
Identical sequences GSADVT00029414001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]