SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00033599001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00033599001
Domain Number 1 Region: 1802-1856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000614
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 2 Region: 631-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 1313-1363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000893
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 4 Region: 1405-1455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 5 Region: 586-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 6 Region: 1453-1501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 7 Region: 1695-1743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 8 Region: 540-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 9 Region: 331-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 10 Region: 767-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 11 Region: 447-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 12 Region: 1367-1402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 13 Region: 1904-1953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000131
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 14 Region: 494-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 15 Region: 1751-1804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family EGF-type module 0.08
Further Details:      
 
Domain Number 16 Region: 1855-1901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 17 Region: 270-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 18 Region: 401-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 19 Region: 677-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 20 Region: 1951-2005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00033599001
Sequence length 2171
Comment pep supercontig:AMS_PRJEB1171_v1:HG380919:174456:182403:1 gene:GSADVG00033599001 transcript:GSADVT00033599001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRELFFLLGWLIATCSSESLRPPYLNLAREKHITVSATSTCGEFIDKQNRNKIKNKKE
LYYSNLIYGQYCDYCDPSVPDKKHIVNYTIDGTDRWWQSPPLSRGLEYQKVNITIDLGQE
YHIAYIYIRMANSPRPALWSLERSIDYGKTFSTWYYFANDIECRTVFGVEPSHNRSFVRD
DDVVCETKYASRIPLEGGEMVVSLINDRPNIKNFSNSDTLQQWTRATNVRLRLLRPTTLH
THSFIHDSQDKSVTRRYFYSIRDIGIGGHCQCNGHAESCDKPHPKTPNKMVCRCRHNTCG
DYCQECCEPFVQKKWRQSRDSGPGAFECEPCQCYGHSTECTYDEKVAEQKLSIDIHGKYD
GGGRCLNCQHHTEGINCERCVRGYFRNFTKKVSDIDMCQSCNCNLKVSTGACAEGTGKCE
CKPQFTGLECDECAVGYFDHAAGCKPCLCSVNGTADHKCLPDSGRCVCKMNFDGDYCDRC
APGYYNFKAGCLPCQCERAGSDGNICDVETGQCPCRLNYQNRTCHSCKNGHYSYPGCLPC
ICNHNGSTVEVCNKDTGACLCKANFVGQTCEHCAAGFFNHPTCEPCACDPTGVIYDACDQ
RGQCHCKPNFGGRQCNQCAPGYFRYPDCVPCSCDMHGSLGLSCDQTTGQCVCKSNFVGEK
CQECAPGLFNFPYCEECVLCLCKQNVEGRQCDRCKEGFWNMKASNPLGCEPCDCSDSGTL
GHLNTCDAVTGQCPCKLTTQNSTARCDICADGYYSLKRDDVFGCEPCRCSLGGSLNSVCD
KHTGQCVCRPFIVGRECNQPSMGHYFPSLHHLRFELEDGLTAKHQTPVRYEFNTDEFEQF
SWKGYVRYSPLQSEVQLHIQLLKPTAYRLLIRYKTYNRTAMDKTGTAAPQTFDIDLPRSD
RQATFASDSTLLTTESAPHNEYLLTLKTTDPILVDYVVFVPIDYIEAEALQQTDVFAFGR
PCELDDEEECYQYYYPSLNGMSTVSHPSSGSVSNGLIIDSNLLQELSVDSLTTIERGRDY
RYDWMISKPGQYYLVVDYHTIDAGTSYARVQTIDGDITPGTLVLTECPYTFVCRQIVTTY
SNGGNQRISKPKIMTVTDTRRATVILNIVQQTDRSSPIGIQKITAVPVAQFNYNLLRPEF
SCVPEDYYNEHLKTSNFPSAPPNTAVVPLNFSTPNIYVYGRLTDVYAKTENYPATFQFHI
HYYQSNSYSVADSVPLTVIFYSRTGDSQIGEINAPICQRRTPGGCSQIIEPHVEKVVIPV
PITADSDRASKFVEECIAKTAPNYDLKIQQASPFCRQALYSLSATFNDQALPCSCDVRGS
TNGNGQCEPYGGQCSCRPNVIGQRCHRCHTGYWGFPNCRQCACPTKICNELTGDCICPPR
VTGRYCDQCAPRTYGFDPLIGCEDCQCRIEGVINGRLDCDLKTGQCPCRANIGSRTCDRC
ASGHYDYPRCMKCDCDAAGTLEPICDTYTGTCLCKENVYGPRCDRCTDGTFALLADNPKG
CTKCYCFGSTTQCHSGIFNYRNKILSYGGNLTFRLSYTSTISNQNQIMNKHPLVILRGRD
LTIVHYYPRPIEANRPEEDISVTLKEANFRFLTRSSAAVTRDTFLQTLSNLSSLHILAWP
YSMDSTSSSLVAVQLQQADLKSANNISPQRPLARSIEVCSCPPNYAGTSCETCARGYYKQ
YSGSNGAHTYTCVPCQCNGQSDICDVETGHCIACQNHTIGTYCETCMQGYNGDPTRNIPC
RICACPLEVESNNFASTCEMNTTTGETTKCFCQQGYYGDRCQSCYPAFWGEPSKVGGRCS
PCECNSNIDPYDWNACDQQTGRCVNCLNNTAGPMCERCRDWFYGDAIRARNCAPCSCSQC
GAIRCDQRSGRCQCKPGVTGLTCDVCLENHYGYHACNDEGCKSCMCGLGSIGPSCDLYTG
QCQCKPGVGGKNCDICLPGYWDLTEDGCKPCQCDRFGTVRDLSNTGLSCDAQTGRCYCIE
GVRGERCDQCEEHYTIVEGRGCLPCDKSNVVPEGWCARQLIDDVDQLRININRTIENADR
IIQGRTANERIQRMRSRADEYRTLVKSPNIRNYRCLANENPSSSFCLNDQINILNRLLNE
FDHDFKQTQIEINHEQEEVKQLAKRVQKQYERVREQVELMRNFADDIDAFSANLTQHTND
DPTYIVNLIDR
Download sequence
Identical sequences GSADVT00033599001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]