SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00035083001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00035083001
Domain Number 1 Region: 175-403
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-55
Family Voltage-gated potassium channels 0.0006
Further Details:      
 
Domain Number 2 Region: 48-131
Classification Level Classification E-value
Superfamily POZ domain 8.64e-27
Family Tetramerization domain of potassium channels 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00035083001
Sequence length 550
Comment pep supercontig:AMS_PRJEB1171_v1:HG380933:530:3414:-1 gene:GSADVG00035083001 transcript:GSADVT00035083001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVAAWLPFARAAAIGWVPLAKNPLPPPPFRIPTNGASPSTNDRRCDEKIIINVSGRRF
ECWRSTLEKYPESLLGSNEKEFFYDEDTREYFFDRDPDVFRVILNFYRTGKLHYPKHECI
AAYDEELAFFDRKRENNERLIDDRLHEDEDKAQPKPQSIRETMWRAFENPQVSTMASVFY
YVTGFFIAVSVIANVLDTVTCGTDPETGYARSCGERFSRQFFCLDTACVMIFTVEYFLRL
YAAPDRLKFIRSVMSVIDVVAIMPYYIGLFMHQKGEVSGAFVTLRVFRVFRIFKFSRHSQ
GLRVLGYTLKSCASELGFLLFSLTMAIIIFATVMYYAEKSVVNTKFTSIPAAFWYTIVTM
TTLGYGDIVPKTWAGKIVGGVCSLSGVLVIALPVPVIVSNFSRIYHQSQRADKMKAQRKA
RQTRIRLARNATSNAFVAAKRRHEQYLDDPDRPVDKNLVNPFELQHHHLLRCLELTTDRE
FVEMGPDVLMGGGGTNTVTGGHPVTGIARLGSPARQFILNRRKWWCCSVRRRKKSTLKNN
TVIFNENDKI
Download sequence
Identical sequences GSADVT00035083001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]