SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00048353001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00048353001
Domain Number 1 Region: 1239-1539
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.84e-16
Family Rhodopsin-like 0.025
Further Details:      
 
Domain Number 2 Region: 896-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000325
Family EGF-type module 0.028
Further Details:      
 
Domain Number 3 Region: 431-466
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000497
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 4 Region: 208-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 973-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000136
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00048353001
Sequence length 1551
Comment pep supercontig:AMS_PRJEB1171_v1:HG381070:117028:121683:-1 gene:GSADVG00048353001 transcript:GSADVT00048353001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYFFYLIIIHFVVSTPHINLYYTDKINEIQHDCIRTTIASISETDMNRQIISYCMSEFV
STTEIQVDKIFPKFTFVQLSELNVTSEDLYKWSASIDLIERYQSYLDQSFEFSFDKEIFY
NCTFPRFGSLCQYKFDHYEIEYLSLHDLIYNYYQIYTYRSMNFTCYTHLKCYRGYSPACL
DWSEICDGKVDCLDGPFDEEYCWQLEINQCQTDEYQCANGQCIPQSFFRDNSNNPDCLDK
SDEIYKPHHQFEECSTSEPTFGCEDITCKHTPLTSSCDARRNDFVRDSMYSTKDNAIDDQ
CWIAMKCLFSLPTPKYPRFIQQIANTKCRDTIKKTCPEIMDFPNLPVLFGQIYTTYLRND
SDYLGNWIHRSPYICSNDSRYADYLEKSTKIFFNNRTCFRSKMIHKVDILTSWKDKYLAP
LNDLFHLLKNHSCTGQSYQCLNSSKCIPIYEIINGIYDCPHHDDENMSIMKNNSNLMNYI
KENYYQCEQSDKYIPAYMIENYECDCGEFTEVYLLCEDESLDYMISRKTISFSTICDGHT
ELLPIEIHGRNQTDETDCEQWECNNIYTHCDNIWNCRNGEDELNCSLNEFNHHQCVSFET
NQFQYLSIEKVNNGQIDCLGGTDEPQLCQTKEFNRITNLFYCINQTQTKCIEDSQLCNMK
NDCEFGDDEQFCKRNRSETIGTNICREHNIELATNVEKFLCQSFETKFKEVMKYFTIEES
IKKVEKSKQEIISNQISSRHSSSYCHRGFDVRISLTNTITRLTCFCPPSYYGNQCQYQNQ
RISLTIRFRSLSNSWQTLFTILILLIDHSHEQMIHSFEQFTYLSIRDCKIKFHNYLLYST
RLKDTRKNYSIHMDIYEKQTFIYRGSFRFPIQFPFLPVQRLALIVTIPQSDHHIDDTCRK
NPCNHGKCIRYVNTFETFCQCEKGWSGKYCDIQYVSMCSSDAISIGISAHNQSICICPMN
KFGSRCLLTNKICEYQCENGGRCIPNDDYMISNKKYTCICPKNYTGIRCQSTIVDNKLNI
LFHKDMDLPSSIFIHFIEVRESRSPVRTSILRNVRQNPMIISWSQVFHLVFIELNNKNYY
LTFIQKNYQSSRILTKTINRSDHCPHIHELFNETFVKLHPIQRIKYYHEPCQRQSLNLSC
FSDNDHFCICYKFGQKRLANCLNFDHEMKYDCFGQSECENSGQCFQDSPDCPKQSVCICR
ACFYGKRCQFSASGFGLTLDAILGYHILPKVSLIHQSSIVQFTFILTLIFIFVGFIDGIL
ALITFKNKIVREVGCGYYLLGSSIATLCTMIIFGLKFFLLVFAQMTIISNRMFLQIQCRS
LDFLLRICLYMDQWLNVCVAIERSITTIRATKFSKKKSRQMAKKVIPCLLIIIISTLIHE
PIYRHLIDEDQNDNDGEYQEKRIWCVTNYPSQLEIYNSILSSFHFFFSFVINLTSAIILI
TKQTRQKSCLQKKRTYQDILKEHLKKQKHLFTAPIVLVILAIPRLIISYTSKCMNSINDS
WLFLIGYFISFLPPMLTFVVFIIPSKFYKKQLKKTVNQYRTYIQRHVQFYS
Download sequence
Identical sequences GSADVT00048353001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]