SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00049094001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00049094001
Domain Number 1 Region: 1045-1354
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000384
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number 2 Region: 793-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000537
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 50-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000707
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 365-402
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000356
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number 5 Region: 4-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000759
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00049094001
Sequence length 1367
Comment pep supercontig:AMS_PRJEB1171_v1:HG381082:183067:187296:1 gene:GSADVG00049094001 transcript:GSADVT00049094001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIITCYPFLSNCSRVSSSICLDWREICDGKFDCIDGEDEEFCEELEINECNQNEYRCHY
GGQCIPLIFLDDGRANVDCLDGSDETDLRISYNDTKLTLSCNSIPTFVCEERTCRYPHSL
SCGDALRWLIRISSNISSHDCPWSMSINININSCESLLTHCSSLWIAIPEQPHLFGFFQF
IYLTNRSNLEFEKNVMPDYVCFNSQRCPGLLPIIVPIEFNNDLTCCHISNLVNKTNVQNF
HQMEFYFKDIIQRCLTIGTELSCSHSSLFHCSRSLKCISYYRLVDGFSDCYFREDENYSA
CHLNDSNRYICVSNSSKCLSFVAVGNLAKDCPSLEDELVSFERIRVQRPPFAYLCNTESE
ILSLIAKNDEIYCEEWPCYTPYVQCDGRWNCHNGIDELNCPDTNCLQNEHYCQLLDKSAV
LCLPIEYLFEKYINNCPRNKSSVYREIYFNNMTNINMSEYISWNKTKCITEDIICNRSHS
LISNFDDEICLYQRPLPVRTPRIDISSINSQTLCSTRRPGYPKSFVSPFASSLHLGFFPP
SSVMDTFEGNLKKIHKTIPELKIAQSSYCNRGILINFRSNQSMIRSKCLCPPSYFGSQCQ
WQNQRISLTLRLSFHSSILANIAFQLIIILIDEFEQILINHEQITFVPIRDCNTKFNIYL
LYPHRPKHISKNYSIRIDIFNKINLIYYTSWYLTIPFQFLPVNRLSTELFIPEISTNQVE
SCLLQCGNHGHCRKYANQELVDFCHCDQGYSGRFCNITEKCSCSNDSFCLSSSICICPIE
KFGLQCYLKHKTCEISNNPCKNNGICIPNDDRINREKFTCLCQEGYSGIRCEISNSYINI
QFDKKLIGTISSILIHFITIFNDKNHERVSTFKKIPFDQNIITLYIEQPFHILLIELINK
QYYLTILREKFINSENITTQLQINQQCYSIYELMNSTLLNYSQFHRVKYYPMICRQYKNI
MCLYDDIYLCICDQYRFSNCFEFNHKVKYDCQKQNLCENNGRCFENNVTCPTKTICVCED
CYYGDKCQLSTKSFILSLDPILGYYIKPNISIHRQPFIVKLSIIIITCLFIFGFISQLLS
IITFIMETPRLVGCGWYLLASSIVSLCLLIMLKIKFWILISSQQARITNRSFLMFSCIIT
DVSLKILLVTNDWLNACVAIERTFTILSGVHFNTKKSKQIAKRLILIVFLLIIITYIHDP
LYRQLIDDYDTDEKRTWCFVRYSSSIDMYNFIINLFHFVTPVFINLIAAILIIISAARSR
FNVERNGIFVQYLKEQLRHHKHLLWGPCLIVLLSLPRLIIPFFSGCMKSPRDPWLFLISY
FISFIPVILHFFLFVWPSKKYMSEFKKAIRQIIRWFHLTFMPNSNRI
Download sequence
Identical sequences GSADVT00049094001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]