SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00051379001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00051379001
Domain Number 1 Region: 95-176
Classification Level Classification E-value
Superfamily HMG-box 0.000000576
Family HMG-box 0.0036
Further Details:      
 
Domain Number 2 Region: 336-391
Classification Level Classification E-value
Superfamily HMG-box 0.0000157
Family HMG-box 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00051379001
Sequence length 392
Comment pep supercontig:AMS_PRJEB1171_v1:HG381121:111499:112972:1 gene:GSADVG00051379001 transcript:GSADVT00051379001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGSRPKPSSNLISDKILVGIKSFRPLRLFITKQKKKGSTENPFTLRVKYCQLPQEKQD
RFLQKAVDKYIELLDEKDVDEQVQVDCKLFDYLLMKGEQKKYFQSINAPIKPPGTAVPFY
TQIVKEENEDDTETSWKSLSTDERKVFKRKRKEAKLEYAAQVKNFANDLPERLRTDYLIY
AEQYPHKRPKIEPTIVNTDESQSIRQRRKSLTALPESLQTPTAAVFSPLSDDIPVKLNRN
QLESLHKCMPNVLYYENAVSNDDKPTFTRTMTKNSYMKSIFSQLDDKERLKYVTKSIKKW
NEFLEENPLIIEYLIPTLHLLLTRQEDIMLYFSSIDLPPRPPINSYLYFNLEKEETGSRQ
SWSDLSPTQKTEYAEQLTARKNEYYQKINSFC
Download sequence
Identical sequences GSADVT00051379001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]