SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00053679001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00053679001
Domain Number 1 Region: 137-197
Classification Level Classification E-value
Superfamily MIR domain 0.000000719
Family MIR domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00053679001
Sequence length 226
Comment pep supercontig:AMS_PRJEB1171_v1:HG385570:42:901:-1 gene:GSADVG00053679001 transcript:GSADVT00053679001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESNLTSSFLKIGDTIALYAEGTVCGFISTLGLVDDRCVVQPDAGDLQKPPKKYRDCLFR
ICPSHRYSAQTQYWNALKSPNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXKKIAMRVSLDVSGTEGSWFQIEPYYKLRAKGERVVVGDKVVLMP
YSGGQPLHVSELELPDHPGSKEVCREFIFMLKKKIIIIRREEKKRC
Download sequence
Identical sequences GSADVT00053679001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]