SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00057976001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00057976001
Domain Number 1 Region: 216-484
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-79
Family Protein kinases, catalytic subunit 0.0000000231
Further Details:      
 
Domain Number 2 Region: 111-255
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-36
Family SH2 domain 0.0000561
Further Details:      
 
Domain Number 3 Region: 39-161
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-24
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00057976001
Sequence length 502
Comment pep supercontig:AMS_PRJEB1171_v1:HG381257:65812:67911:1 gene:GSADVG00057976001 transcript:GSADVT00057976001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCWFSTDDNPKREIILEDISKTKTEESAIKSRGTPTPVKTPPKVLRKYEKIYVAIYDYE
ARTDDDLTFRVGDLLTILDDSQTDWWLARHCQTRLQGYIPALYVAPRDGLDAKEWFHKDI
QRKEAERCLLNPNHLPGTFLVRNSEKPPGPYSLSVRDFDEQRRPHVKHYKIRYADENFGY
FITQRRIFPTIEELINHYKKNADGLCNQLTRACPRSKPNTCTMSKDVWEVSRDSLQLSKK
LGQGMFGEVWAGKWNNKIDVAIKTMKPGTMSTQAFLDEANIMKKLRHDKLVQLYAVCTEP
QDQPIFIVTELMCNGSLLDYLRQGPGKELKLPALIDMAAQIAFGMAFLERERYIHRDLAA
RNILVGENNIVKIADFGLARIINEDIYEARPEAKFPIKWTAPEAAIRGKFTVKSDVWSYG
ILLYELITYGQVPYPGMSNREVLEQTLRGYRMPRHENCPEAIYRYMLRCWDASPDSRPTF
EHLYAFFDDYITSTGPQYQNQN
Download sequence
Identical sequences GSADVT00057976001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]