SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00058938001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00058938001
Domain Number 1 Region: 149-244
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-24
Family Kelch motif 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00058938001
Sequence length 244
Comment pep supercontig:AMS_PRJEB1171_v1:HG381275:91986:92998:1 gene:GSADVG00058938001 transcript:GSADVT00058938001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLVIVLFLGVFLSCVESLLIRFFVYAFSQYVLFLGQTTEASTYSCNENNGNIKFTLSSS
PHSAWNPDSNCSLQQCHVSSINSCSSSSTPCFDYRTFDNSRYCAPGILCSILEPCNNITF
TCASNTSVCIVNSCCSPQAMCLPLLSTNFCISGWFNIASMNYPRQWHTSSVLSNGKVLVT
GGMSDSSTYLSSAELFDPSTGTWTTTGSMNNARSQHTASVLTNGKVLVTGGMNYTDYLNT
VELY
Download sequence
Identical sequences GSADVT00058938001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]