SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00061083001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00061083001
Domain Number 1 Region: 222-403
Classification Level Classification E-value
Superfamily MIR domain 2.09e-28
Family MIR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1100-1232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.79e-16
Family SPRY domain 0.025
Further Details:      
 
Domain Number 3 Region: 666-811
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000137
Family SPRY domain 0.048
Further Details:      
 
Domain Number 4 Region: 4223-4286
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000198
Family Calmodulin-like 0.068
Further Details:      
 
Domain Number 5 Region: 2272-2358
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000418
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 
Domain Number 6 Region: 104-184
Classification Level Classification E-value
Superfamily MIR domain 0.00000942
Family MIR domain 0.029
Further Details:      
 
Domain Number 7 Region: 446-539
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000667
Family IP3 receptor type 1 binding core, domain 2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00061083001
Sequence length 5269
Comment pep supercontig:AMS_PRJEB1171_v1:HG381342:76754:100200:-1 gene:GSADVG00061083001 transcript:GSADVT00061083001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEHMVGGEEDDVQFMRTEDRLCLSCVPVSAIKRMALSGEVFGNRMCYLEDISNEVCCP
DLASCIFVLEQAVSVRALQEMVSTTSTEQTSASQGGQTTFRTLLYGHAVLLRHYHSQMYL
SCLSTSTSNDKLAFDVGLKEDAQGESCWWTIHPASKQRSEGEKVRFNDDVILVSVFSERY
LHAYMSTSERGRVNASFRQQVWSLVPISSGVARVKNPGFVLGGDVIRIMHGNMDHCITTP
PPDSQVIDDSGSLFIKSGASCQQARSLWRIECFKIKWYSGFVGWSSLVRLRHVTSGLYLA
VIGDENGPKVTCISKKNASAIAVTFEMKMSKEKQAEEISEQENLGVPTIKYGDTIVFIRH
VDSDLWISYETLELTIKGIGKVEEKRIIPAVEGHMDDCFRLVRAQEQEQKTALVIRICNA
ILGRFNRTDPMSIDAETANHLLSKSDVVQALLKDLIGFFSQPSPTLDHEERQLRLKVLKN
RQDLFQEEGMIRILIAAINFFSERRDKSLLLEGVEEKIENITNKLYVVLAALIKGNRTNC
SNFAQTARLNWLVNRLQSQQASGGVLEVLHSVLVDSPEVLNMITESHILAIIALLDRNGR
DPKVLDVLCSLCVNNGVAVRANQNLICENILQRRDLLLQTALVDHVACMRPNILVGVEDG
DSMYKKWYFEVVIDHIEQVTHVQPHIRIGWATTDFQPSPGHGDGFSSNGIGDNTYSYGFD
GRNVWFAGRAYDVSNRVVLPTDNMQHIGFKKNDVIGCLLDLNIPEMWFSLNGLPVKGLFR
EFNLTGMFYPAISLSSRVSCRFIFGAEHGRFIHRPPEGAAPLYEAMLTKQKVSIEPCFSF
GNIERNRLDGPTQFQHHIAFTPQPVRTNHIVLPVHLENVRDRLAENIHEMWSMNKISSGW
RFGEFRDDSQKMHPCLTTFDRLPLAEKQYHTTTAMENLKSLLALGYHIGVEIKTDDRRLK
YVKLPNTYVQANGYKPQPLDLSNIVLSTKMEELIETLAENTHNVWAAGRIKDGFTYGVAD
NPRQKRSPHLIPYAIVDDSIKKINRDTASETVKTLLAYGYTIESPTGDAEDLNRHNKEAA
NSARCEHISNYRTYRAEQTFAVSRGKWYYEVELLTPGRMLIGWAQVSKLDAAYPLGTDSH
GYGYAFDGLNARRYHHNLFEGFGKQWSKNDVVGCMIDLHDKTISFSLNGELMLDNFGNET
AFDGLEVDGLGYVPALTSFSGQKARLNFGQDVNTLKYFTSCGLQEGYEPFCVNMTRSLTF
WYSNFIPRFETLKSDSSSFEVTRIGASRDNPPLIKLQSRLLGTLDKVEFEFLRLSLPLCC
HDKFTPKQVTLERRQLALQEYIDSQEEKRAFAFPPTSGSASRTKSFSHGTSDTIDSHLTN
QTDTNPNFLSPDSITNKSGRPSPSPSMANGTGQGGLMNGSSTNESIDRLSKTNPKGSTSK
INNFFQRFSKEPQGPNEQQPKVSKRIPTKQLNNINTRRSFTENEAELNDQANDFEHDEIR
AINEHVYEFYYAVRILPGQNPRSVFIGWVTSRFKPILLKESLPDDTSTTSASKLSKLIRR
CTITQTGEDGSILESASRQDAYMFCASDLLDNMPDQEAVARRVVNGLLIGCLCDVSTGQL
TFYVNGKESAQKLEKSTAVDIETSGKCMKRANPNNQIFSITSLYSVEPSTKLYPAVFVEP
TVKEVLQFELGRIKNCLPLTAALFPSLNREERFLPQLPSRLNLQSLIRCHWSRVPNTNLR
CQQLKLSDVRGWSVFVEDPVQMEAVYIPEDDRCTDILNLVEDEDNLNFCSNTLTLYNAIC
AQGNNRVSHEICKLVDEKQLMYCVKNPYLCGPIRIGIHNLLIALHFETHVKARSLTSHEF
IIPLSSLLRKNTVLHSQNSAEQQHMYATTTKSLLKNFHLLFFHYQSFKIERERKLLVPPL
FNVLSLKEYIMNSLTDAIGKNSSHLRDPVGGTYSNWLVPLLQLVDSLLVMGLLEVNDIQQ
LLHLIDPASFGLDSDKHLDEGLLQMKLDEPVKLQLCFVLQHLCNYQLQYRIEACVAFSEE
FVGRLQADQKRRYNVLKESSLPPALMAKKTREFRCPPKDQMQALMDFKRESEEEAVGNED
IQEEIKDMLKTFHSNLLILQQVVEANDDFSNATKLSKTNEMDHAEQISLFSRLLEILIRH
ALKKNDNKSMNNFNNQLMWKPGKTLCEVIKSTVIKWGRGTHIADPNLIREMFKLIYNQYD
GIGEVSRCIERAYIINEKSVPDIKLLLRKLSIVRALLTVQMDSDEEEMMIACLNDIMDNR
VFYQHPDLMRTLCVHETVMAIMVNRLNKSKQEQTSMSSMNDMDVELVTTCCKFLSYFCRT
SRHNQRAMFEHLSYLLENSSMLLSRPSLRGSAPLDVASASVMDNNELALALRESHLEKIA
SYLSRCGTTRNEELFLQGYHDIGWDPVDGERFLDFLKFCVWVNGDTVEENADLVVRLLIR
RPDCLGPALRGEGGGLLKAIREGIAQSLYIARRQNSDDPNSNDRLQVRLPYEDDEEYIDL
GAAELSFYAILVELLGRCAPSEETIKMGKPNAVRAKSILKSLVSMHDLEGVLGLKFLLPN
DNSMPPGLQPAHKMSIILFLERVYGIPDQETFFRLVEDAFLPDIRAATILDMAAIAESDM
ALALNRYLCNSVIPLMTSHSQYFDDCEHRSSLLESTLHTIYRLSKCRSLTKNQLDVICDF
LLAFASQLKPSMMTPLLIKLVHDVPELTDQTIVPLRMLTQWYERCSRYYSVAATEEEKRL
TMLLFQKIFDALASRAYDPELFGKALPCLTAIGSALSPDYSYALSQQDYLDQEQEKIEMS
RMYEPNPADTSNVVLTPELEEFVKAYGESVHDQWSYAKMEQGWTCGEQINDKYRQHPNLK
PYKQLDRKDTAKLEDPIREALKSIEKLQFHLEKTDTGVTRIATKPLQRKKQKDKTAPDYI
PKSMDFASVTINREMQQLSEALAKNAHEIWARQLKNRLAAIGGGLHSRLVPYDLLTDKEK
QKDLKFYQDLVKYLNIFGYRVVKKTSEDDTANNAVAALVSSTSSLTAVTTSQMSEKRFAY
SLLEKLLEYVERASSTMQNYKESSKFSLHESYRLSTKDVKFFGKVVLPLVEKYFQAHRDY
FITPSSLKTGSGYATVKEKEMSCSLFCKLAFLLRQKFSAFGNEVNISVRCLKVLVRAIDV
SSVMKNSQEMVRASLLPLFNNIAEDLNQTVQNLEQKRFSHIKGTLQRGTTSLAYVHMVLL
PVLASMLDHLGKNNYGIDVFENEIQLAGYKILNALWIIGTQGTRFVDREWIIEELNRHRP
LLGDCLSSFASCFPIAFFEPEFNGNNKHASNISQLSPEANDVMTNITRTIPHLTKVIADI
EEHSESRIKYEDAPHAIEVILPCVCSYLPYWWSVGPQKAKQSNEPKVTNVTVEHMNSVLG
SVLKLVNNNIDAPEAPWMKHILIGYTQGIILNSSTSLLEPYFLPVSQRLKAKCEDLFAQE
QSLKHATRLESSEREDLEANLMKNYEILVRDLYAFGPLLIKYVDIHRSYWLKNGDICADQ
LFNNMAEVFSTWCKSKYFKREELNFVSQHEIDNTSMLMPSSTNQSSAGSTNPSDGSAMKS
SGDMSNGGASGGKQKRKKRRLDKEKFTSLSVACIKRLLPVGMNTFGGREQELVQLAKHKM
IETKIAHDEKIENPTEEQMILDLTTDQEESIEEFLRDIFFAQEQGEVVNRNNWQSALYRK
IGSKSHQTGIIHSQATSIKNMLKMAKVLFGLNLVDHPPTHRRGTWRKLVSSQRKKAIMAC
FRMAPLHSVPRHRAMNMFLRAYRELWLEAEEDTRARLIEQLCEEYLEINDQEVTTIKEEN
ETETEVLTLTMTMKPDPLRQLLQCLNRAATTAQLFSITEDIVYLSYSTIMSKSCVIEEDD
DDGGAEEVKSFQEQEMEKQKLLYEQNRLANRGAAETVLLYISASKGENNEMLQRTLQLGI
SLLHGGNREVQKRMLDYLKETKDVGCFTSLATLMANCSVLDLDTFERCIKAEVLGVGADG
MAGEKNLHDADFTISLFRFCQLLCEGHNLEFQNYLRSQPGSNTNVNIIICTVDYLLSLQE
SLMDFYWHYSGKETVDAHGKENFCRAINVAKQVFNTLTEYIQGPCPQNQLALANSRLWDA
IAGFLYIFAHMQRKLSQDPMQIELLRELMKLQKDMIIMLLSMLEGNVLNGPIGKQMVDTL
IESQSNVELLLQFFDIFLKMKGLTTSEAFQEFDTNKDGFISPKEFRRAMEAQKMYTTQDI
DYILMCVDTNQDGKIDFMEFTERFHNPAKDIGFNMAVLLTNLSEHMPHDIRLQRLMDKAK
SFLSYFQEYLGRIEIKGGAGYIERVYFEITESNIEQWNKPHIKESKKAFLHLVVNETDDK
EKLEQFINFCEDTIFEMQHAVALSGEEDDQVTPTTTFSDEELGNGHPTTKEPVKLALSYT
WSGIKGLFHLLRPSTIRNGYQQFRQMTLKDMIKSLFALFVKFLHLLLIIIIYAFSLHVFF
VMKYFLPKRWYYCVGRILNRFLINLLNVDVALRHKNCEYNHSLTSSKYRNVSRYFFHEKK
SYLSNYQRLKQSTNDSHIHPKRYRFVASYSITLTYCIWNLMVGEDQQEIKVERVALPPPT
KRRDHHLPSVNISQVGFSTGEESSPMNAFGVGLSSDPSSKHKISLNEESINTLNFDGVQT
FDSDQKSLYVNNIDSINGHAIPASVSTTAHIIPSTQHTQHQHSITASVPHQPQLTTTIHM
SPNMIEKSKQSLEVNIQAEYQQKIPTINANGTIVEDDDFIPTDPPARTDYGKKILALVAR
NYHQLKFMALCLAFVINFLMLFYKALPLAAAASEPVASDAIERIDEDDDEVIMMDPKNFY
MVYLLRISAFLHSFIAFLMMISYYKLKVPLVIFKREKEIARKLEFEGAWLLDQPSENNSW
ILSYLSREWHKLVISSKSFPDSYWDKFVKKKVRNKYSDQFDYDELSRFLGMEKNDTPGKF
EIVKPVETGLWGKIQSIDIRYQVWKWGVIFTDNSFLYVFFYFLFSVIGNFSFFVFAIHLL
DVAISVKALSTILKSITHNGRQLLLTIMLMAVLVYLYTVIAFNFFRKFYTKEEDEEKEEN
CKDMFTCFKFHLYSGIRAGGGIGDELESPNGDPLELYRIIFDITFFFFIIVILLAIIQGL
IIDAFGDLREQLDSVKETLESKCFICGIGQDYFDKEPHGFETHTTAEHNFANYMFFLTHL
LNKPDTEHTGQESYVWEMYQSRKWDFFPVGDCFRRQYEPGGGGAASTES
Download sequence
Identical sequences GSADVT00061083001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]