SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00061671001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00061671001
Domain Number 1 Region: 22-81
Classification Level Classification E-value
Superfamily MIR domain 9.02e-17
Family MIR domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00061671001
Sequence length 83
Comment pep supercontig:AMS_PRJEB1171_v1:HG387316:548:852:1 gene:GSADVG00061671001 transcript:GSADVT00061671001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLIQWSIFIYLLQLSASNEDVMTCGSTFKLLNQQSGDRLHSHDVKYGSGSGQQSVTGT
PNADDVNSYWQIRGDIRNDCERG
Download sequence
Identical sequences GSADVT00061671001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]