SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00064967001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00064967001
Domain Number 1 Region: 243-516
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-62
Family Protein kinases, catalytic subunit 0.0000096
Further Details:      
 
Domain Number 2 Region: 151-273
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000712
Family SH2 domain 0.0069
Further Details:      
 
Domain Number 3 Region: 50-134
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000614
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00064967001
Sequence length 519
Comment pep supercontig:AMS_PRJEB1171_v1:HG381489:13029:14588:-1 gene:GSADVG00064967001 transcript:GSADVT00064967001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLCPQGLPDHPPTPPNNNSKGVKFSNIKQPIVHVYDADPNNEPLQAPPRPPPPLKHLP
KPIPQNDQSRVLLHTPIYIAKQSYEKTNDDQISFENDDEMELIEEINSNELRVNHLRSGL
SGIVLKKYVQIDVDTPLRLAVQEFGVIQRCLVHYNVFGGYLIRRSASVPNSFVLSILQSN
KHHQTLTWNYLICIHPSNKYFYFHQEDKLKTIFFSSFGQLVADQRVHAVIPLTEIVPYAI
EFDKEVWNIPYNELKIDQKIGEGQFGEVFRATWHRGRQDIPVAIKKLRIRGITSTVQREI
EAMKVLTNLYVVTLHGVSENPGTNEILIITELMENGDLRTWLKNLPNLPEYSTLVRFAKD
IARGMSYLEFRNYVHRDLACRNILVGPGARRVRIADFGLSTILNPADEGQRQEARLDKLA
TRWLAPELLGDQAEYSLKSDVWSFGILLIELWQKGGDPYENEHRAWIQGAVRTGYVHEKP
TDCSDDFYQSIICQCLKFESNDRPTFSAIRKLLETWQCS
Download sequence
Identical sequences GSADVT00064967001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]