SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00065442001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00065442001
Domain Number 1 Region: 405-615
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.2e-48
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 87-198
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000064
Family DNA topoisomerase II binding protein 1, TopBP1 0.065
Further Details:      
 
Domain Number 3 Region: 216-309
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000218
Family DNA topoisomerase II binding protein 1, TopBP1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00065442001
Sequence length 908
Comment pep supercontig:AMS_PRJEB1171_v1:HG381518:48662:52694:-1 gene:GSADVG00065442001 transcript:GSADVT00065442001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEIQKTQNDESSSSEDWTITFCVIGKACSNIRLLASLEDRYAYDCLTDEDHVLRTLSET
KQLLTKRQLRIYVIESFDENLFYSLKEDENIYIISAELVLTCAEKKIDIPVPRRNRPLYS
QHLVSAVICFVGGTRREIHTKFSDIVHYLGGSVRKDYSDQVTHVVSFANLGEKYLTAFNM
ERSEILTEDWLLECWKEKDNRNFDALNTDFIRTYRAKPLHNLNLFFFGAADDTERRHLNT
LTVDNGGYTTNEISDATHIVFCNGMDANTFLSTYPSYKRKHRQHIVNVQWFWECLCLMGK
ADESSYSIKLPGMNETTTPDSPRSTLLSLSTLSPLSTSINDSNYMQQHNATASVKRKRRK
ESNTTTENNTTPNNKRFNSNNENESVLDDDMLTENFDKQKTPNIKKDNRYLIGMEIRETE
RNYVTMLSNIIRFFKTEMEKDDRRNGPILTKVESAQIFGNIEEIYHLHLTIAEQLDRALN
EDACIGSVFLANAAELLRVYQPYTKFYDKTIQAIHSLEKNNSRFYAYLKICEHKSELGKQ
HLADLMIRPIQRLPSVLLLLERLLKYTPNTHADHQQLTNAMDKLREVAKKLNEERGKTEK
HLSLFSIVNSIDNCPPELLAAHRDYIQKFNLMELSQELTGKRTHLTLFLFSDCIEITKLR
VNTWKTPGVKSTKLYKHVALIQLSDIRSLFDIAASSCDENEQFGMLCSIDGQARQLIFRV
ADNHMSISRSHLTDSMTSLTSLSTVSSVNQTSKTEVLQHLAKAIAEERCLLDKTSLIENV
GPENGAFTPLSSMDFMSDNDTLSTHSTMSATTTSGLNSVGSALRTGLYKAKNRLSRTFSF
SPISSKNRLKKMLTSNSSLLQLNDKDNNNFNTMKRLSVPSRQDSFTSERNFPQSPSRFMH
SIQECKFK
Download sequence
Identical sequences GSADVT00065442001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]