SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G05756.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G05756.1
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000182
Family 7-Fe ferredoxin 0.0000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G05756.1   Gene: BRADI1G05756   Transcript: BRADI1G05756.1
Sequence length 81
Comment pep:known chromosome:Brachy1.0:1:3906642:3906887:-1 gene:BRADI1G05756 transcript:BRADI1G05756.1
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACST
DFLSVRVYLGPETTRSMALSY
Download sequence
Identical sequences I1GMA8
EG:BRADI1G05756.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]