SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G43607.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G43607.1
Domain Number 1 Region: 69-654,683-692
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.7e-162
Family Prokaryotic type I DNA topoisomerase 0.0000000112
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G43607.1
Domain Number - Region: 676-724
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00833
Family PhnA zinc-binding domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G43607.1   Gene: BRADI1G43607   Transcript: BRADI1G43607.1
Sequence length 877
Comment pep:novel chromosome:Brachy1.0:1:41412885:41431171:1 gene:BRADI1G43607 transcript:BRADI1G43607.1
Sequence
MESGTSKSKKSVGSSKEKKTVNRSKRSSKAEESAGAIAPAEAKNCIKTSVDSSGGEGKPL
MPLHPPIAKSVVVVESATKAKVIQKYLGDMYEVLPSYGHVRDLAGKSRSVRPDDDFSMVW
EVPSAAWTHLKSIRVALKGAENLILASDPDREGEAIAWHIKEMLEQQKALGCHVTVARVV
FHEITEDAIKNALMFPRYIDMDLVNAYLARRSLDYLIGFGISPLLWRKLPGCRSAGRVQS
AALALVSDRETEIEQFSPQEYWTVDTDFKIRCSDSSKGLCLTSRIKHLNSKKLDQLSISS
QEEARAIEKRIYSSQFEVRGVKRSKIHKNPPMPYITSSLQQDAANKLHFSAGHTMKVAQK
LYEGISLSSEEATGLITYLRTDGFHISDGAAEDVRSLVKERYGEQYASEDVRKYLKKVKN
AQEAHEAIRPTSIRRLPSSLVGILDEDSLKLYALIWRRTMACQMEASRTELIQVDIGNPG
GDMTFHSSASKLDFKGYQAVYDDTEASGSSENPEGEALHHDNFEALSKLEMKDLVSPVNV
HLGQHFTKPPSRYSEGALIKKLEELGIGRPSTYASIMRVLQDRKYVTIKSRVLHPEFRGR
MVSAFLSHHFSEIADYSFTANMETELDNVSAGSTEWKGLLKDYWERFSKYCGDASQWDVR
KVERMLEEKFRPILFPDLDDASRICPSCSEGTLRFKVSRFGEGYFIGCDRHPKCKYIART
LSDEDDENEACEETKWNFEPRLLGVMPNLNEKVFLKQGPYGYYIQVGEDRKGISQKRASL
SEVKNVDSITLEDAIELLQYPKILGKHPDDEYPVLMTHSKAGFSVRHRRTVAPLPKNTDL
KKITLECALKLLAGKNVKKFGRPLGKQNKSKEPHEWH
Download sequence
Identical sequences I1GZ20
EG:BRADI1G43607.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]