SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G34290.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G34290.1
Domain Number 1 Region: 4-625
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 7.32e-150
Family Prokaryotic type I DNA topoisomerase 0.0000363
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G34290.1
Domain Number - Region: 615-658
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0586
Family Ribosomal protein S27e 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G34290.1   Gene: BRADI4G34290   Transcript: BRADI4G34290.1
Sequence length 868
Comment pep:novel chromosome:Brachy1.0:4:39944194:39952345:1 gene:BRADI4G34290 transcript:BRADI4G34290.1
Sequence
MAPKVLMVAEKPSIALSIASAISGGRMSTRKGSTDVHEFDGTFQGSQAFFRVTSVIGHVF
SVDFPPAYQNWEGTDPVDLFNAPVLRSECNPKVHIRRHLAQEARGCTYLILWLDCDREGE
NICYEVINCTGIPENEVGRRIFRAKFSSVTEKDISNAMDNLVLPNKDEALSVDARQEIDL
KVGVAFTRFQTRYFQGKYGNLDSRVISYGPCQTPTLGFCVQRYQQINTFKPEKFWSLRTY
VIKDGDEIQLEWDRKKLFDFDVTVMFQKMVANDGTLIVTDISVKEECKARPSGLNTVNLL
KVASSALGIGPQTAMHMAERLYTQGYISYPRTESTAYPASFDFRSVLSALVHNPLWSNNI
RTLMDAGFVKPRQGHDAGDHPPITPMRSASEEALETDAWRLYQYICQHFIGTVSPDCRYT
RTAVEFTSGGEIFRCVGHRVTSKGFTSIMPWLAVAENNLPTFKNGDTVSIHKVDIYEGST
TPPDYLSESELISLMEKNGIGTDASIPVHINNISERNYVQVNSGRRLVPTALGTTLIRGY
QCIDADLCLPDIRSFIEQQITLIAKGKADHLQVIQHVIQQFMKKYSYFVKKIENMDALFE
AQFSPLADSGRLLSKCGKCGRYMKYISTQPMRMYCITCEEVYYLPQNGTIKLYKEIICPL
DGFELLLFSMVGPDAKSFPLCPCCYNSPPFEGIDKLFGAIKLDDTGKLGKGAGMPCFLCP
HPTCKQSMITQGVCACPECSGTLILDPVSAPKWRLLCNMCNCVVLLPHAAHRITTTDKKC
STCESTIIEVDFNKKATPLEDGATLHEGCILCDELLHSLIEMKHGKSFFMRRGRGRGRGR
ARGRGGSRGRGRRGNSRHDDPKMSFRDF
Download sequence
Identical sequences I1IRH1
XP_003578369.1.954 EG:BRADI4G34290.1 15368.BRADI4G34290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]